Recombinant Tuber melanosporum Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
SEC11; GSTUM_00011219001; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Tuber melanosporum (strain Mel28) (Perigord black truffle)
Target Names
SEC11
Target Protein Sequence
MDALGLSKLRHLKPRQLLSQVLNFALILSTAFMLWKGLSVATDSPSPIVVVLSGSMEPAF QRGDLLFLWNRNLELDSPPTPGTRVGEIVVYNVIGKDIPIVHRVVRKHQGPKTPLHLLTK GDNNHADDTELYARGRWYLDREKEVIGSVVGYVPFVGYVTIMLSEHPWMKTALLGIMGLL VIVQRE
Uniprot No.

Target Background

Function

The recombinant Tuber melanosporum Signal peptidase complex catalytic subunit SEC11 (SEC11) is a catalytic component of the signal peptidase complex (SPC). SEC11 catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum. This signal peptide cleavage occurs during protein translocation, either co-translationally or post-translationally, through the translocon pore into the endoplasmic reticulum.

Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Signal Peptidase Complex in Tuber melanosporum?

The Signal Peptidase Complex (SPC) in Tuber melanosporum, similar to that in other eukaryotes, is responsible for cleaving signal peptides from nascent proteins as they are translocated into the endoplasmic reticulum (ER). This essential process ensures proper protein trafficking and secretion within the fungal cells. In the well-studied yeast model Saccharomyces cerevisiae, the SEC11 subunit has been identified as essential for cell growth, signal peptide cleavage, and signal peptidase-dependent protein degradation . Given the evolutionary conservation of this mechanism, T. melanosporum SEC11 likely performs similar essential functions in protein processing during various developmental stages of the truffle's lifecycle, including mycelial growth and fruit body development.

How is SEC11 expression regulated during different developmental stages of T. melanosporum?

T. melanosporum undergoes distinct developmental stages during its lifecycle, from vegetative mycelium to mature fruit body formation. Based on genomic studies, T. melanosporum possesses approximately 67 programmed cell death (PCD)-related genes that are expressed during fruit body development . While specific SEC11 expression patterns are not directly addressed in the available data, gene expression in truffles generally follows developmental stage-specific patterns. Expression levels can be quantified using techniques like qPCR and DNA microarrays, which have successfully tracked expression of various genes across developmental stages 3-6 of fruit body formation . Such methodologies would be appropriate for investigating SEC11 expression patterns in relation to truffle development, particularly during transitions between vegetative growth and reproductive phases.

What is known about the genomic structure of SEC11 in Tuber melanosporum?

The genomic structure of SEC11 in T. melanosporum would include its coding sequences, regulatory elements, and conservation patterns. While the provided search results don't specifically detail the genomic structure of SEC11 in T. melanosporum, genomic analysis approaches similar to those used for identifying the 67 PCD-related genes could be applied . Analysis should examine exon-intron organization, promoter regions, and potential alternative splicing patterns. Comparative genomics approaches could reveal sequence conservation with SEC11 homologs in other ascomycetes like Saccharomyces cerevisiae, where SEC11p has been well-characterized as an essential component of the signal peptidase complex in the endoplasmic reticulum .

What are the optimal conditions for expressing recombinant T. melanosporum SEC11 protein?

For optimal expression of recombinant T. melanosporum SEC11, researchers should consider several experimental parameters. Based on similar fungal protein expression systems, a heterologous expression system using either E. coli or yeast (P. pastoris or S. cerevisiae) would be appropriate. For prokaryotic expression, codon optimization is essential due to the different codon usage preferences between fungi and bacteria. For eukaryotic expression, S. cerevisiae might offer advantages since SEC11 is a membrane-associated protein in the ER, requiring proper folding and potential post-translational modifications.

Experimental parameters to optimize include:

ParameterRecommended ConditionsRationale
Expression hostP. pastoris or S. cerevisiaeBetter for eukaryotic membrane proteins
Temperature18-25°CLower temperatures may improve folding
InductionMild induction (0.1-0.5% methanol for P. pastoris)Prevents aggregation of membrane proteins
Buffer conditionspH 6.5-7.5 with mild detergentsMaintains native conformation
Purification strategyAffinity tag (His or GST) followed by gel filtrationPreserves protein activity

Validation of proper folding should be performed using activity assays based on the peptidase function, as seen in studies of yeast SEC11p which has established roles in signal peptide cleavage .

How can researchers develop specific antibodies against T. melanosporum SEC11 for immunolocalization studies?

Developing specific antibodies against T. melanosporum SEC11 requires careful antigen design and validation strategies. Start by identifying unique epitopes in the SEC11 sequence that differ from other fungal species to ensure specificity. Based on the membrane-associated nature of SEC11 proteins, targeting hydrophilic, surface-exposed regions will increase accessibility for antibody binding.

Recommended strategy:

  • Perform sequence alignment with SEC11 from related fungi to identify unique regions specific to T. melanosporum.

  • Select 2-3 peptide regions (15-20 amino acids) with high antigenicity and surface probability.

  • Synthesize these peptides with a carrier protein (KLH or BSA) for immunization.

  • Immunize rabbits or mice following a standard immunization protocol with at least 3 booster injections.

  • Test antibody specificity using western blotting against recombinant T. melanosporum SEC11 and native protein extracts.

  • Validate antibody for immunolocalization using both positive controls (tissues known to express SEC11) and negative controls (SEC11-null mutants or tissues with suppressed expression).

Careful validation is critical as antibody cross-reactivity with related fungal proteins could lead to misinterpretation of results in immunolocalization studies examining SEC11 distribution during truffle development.

What advanced genomic approaches can be used to study SEC11 function in T. melanosporum?

Advanced genomic approaches for studying SEC11 function in T. melanosporum include both gene manipulation techniques and high-throughput expression analysis. Given the challenges of genetic manipulation in truffles, multiple complementary approaches should be considered:

  • CRISPR-Cas9 mediated gene editing - While challenging in T. melanosporum, this approach could create specific mutations in SEC11 to study its function. Delivery methods would need optimization for truffle cells.

  • RNAi-based knockdown - Design specific siRNAs targeting SEC11 mRNA for transient reduction in expression levels, allowing assessment of phenotypic effects.

  • Single-cell RNA sequencing - This could reveal cell-type specific expression patterns of SEC11 across different developmental stages, similar to how SEC11A expression has been characterized across different cell types in tumor microenvironments .

  • Comparative transcriptomics - Analyze SEC11 expression patterns alongside other genes during fruit body development stages, similar to the approach used for PCD-related genes .

  • Chromatin immunoprecipitation sequencing (ChIP-seq) - Identify transcription factors regulating SEC11 expression during different developmental stages.

For quantitative assessment of gene expression, real-time PCR techniques similar to those used for quantifying T. melanosporum mycelium in soil samples could be adapted for SEC11 expression analysis .

What role does SEC11 potentially play in T. melanosporum fruit body development?

SEC11 likely plays a critical role in T. melanosporum fruit body development through its function in protein processing and secretion. The formation of truffle fruit bodies involves complex cellular differentiation and tissue organization, requiring precise trafficking of proteins. Based on studies in other fungi, SEC11 as a catalytic subunit of the signal peptidase complex would be essential for processing secreted proteins involved in cell wall modification, extracellular matrix formation, and intercellular signaling.

The development of T. melanosporum fruit bodies proceeds through distinct stages, from hyphal aggregation (stage 1) to the formation of mature pigmented ascospores (stage 6) . During these transitions, programmed cell death (PCD) occurs in specific tissues, particularly at the interface between developing sterile and fertile veins, and in some developing asci . The proper trafficking of proteins involved in these developmental processes likely depends on functional SEC11 activity.

The expression patterns of numerous genes change significantly across developmental stages, with some genes showing stage-specific upregulation . While SEC11 expression patterns specifically are not detailed in the available data, its essential role in protein processing suggests it would be active throughout development, potentially with increased expression during stages requiring extensive protein secretion, such as the formation of fertile veins and ascospore development.

How does SEC11 potentially interact with other components of the signal peptidase complex in T. melanosporum?

Based on studies in Saccharomyces cerevisiae, SEC11 functions within a multi-subunit signal peptidase complex. In yeast, the complex includes SEC11p, SPC1p, SPC2p, and SPC3p, with both SEC11p and SPC3p being essential for cell growth and signal peptidase activity . T. melanosporum likely possesses homologs of these subunits forming a similar complex structure.

Predicted interactions within the T. melanosporum signal peptidase complex:

  • SEC11 would serve as the catalytic subunit, containing the active site for peptide bond cleavage

  • Other subunits (homologs of SPC1, SPC2, and SPC3) would provide structural support and substrate specificity

Protein-protein interaction studies would be critical for validating these predictions. Techniques such as co-immunoprecipitation followed by mass spectrometry could identify binding partners of SEC11 in T. melanosporum. Yeast two-hybrid assays using T. melanosporum SEC11 as bait could also reveal interactions with other signal peptidase complex components.

Understanding these interactions would provide insights into potential regulatory mechanisms of signal peptidase activity during different developmental stages of the truffle lifecycle.

What are the implications of SEC11 function for T. melanosporum symbiotic relationships with host plants?

T. melanosporum establishes ectomycorrhizal relationships with trees, predominantly oaks and hazelnuts . This symbiotic interaction involves extensive protein secretion for intercellular communication, nutrient exchange, and interface formation. As a key component of the protein secretion machinery, SEC11 likely plays a vital role in processing proteins essential for establishing and maintaining this symbiotic relationship.

Specific implications of SEC11 function for symbiosis include:

  • Processing of secreted effector proteins that modulate plant immune responses

  • Maturation of hydrolytic enzymes involved in nutrient acquisition from soil

  • Processing of membrane proteins involved in nutrient transport at the plant-fungus interface

  • Maturation of signaling molecules mediating communication with the host plant

Research on other ectomycorrhizal fungi suggests that protein secretion is differentially regulated during different stages of symbiosis establishment. SEC11 activity might therefore be particularly important during the early stages of colonization and during the formation of the Hartig net, where extensive membrane remodeling occurs.

The effectiveness of SEC11 in processing these symbiosis-related proteins could potentially impact truffle productivity in orchards, which is known to correlate with mycelial abundance in soil . Studying the relationship between SEC11 function and symbiotic efficiency could provide insights relevant to truffle cultivation practices.

How does T. melanosporum SEC11 compare structurally and functionally with SEC11 homologs in other fungi?

T. melanosporum SEC11 likely shares significant structural and functional similarities with SEC11 homologs in other fungi, particularly ascomycetes. In Saccharomyces cerevisiae, SEC11p is an essential component of the signal peptidase complex required for cell growth, signal peptide cleavage, and signal peptidase-dependent protein degradation . Structural conservation would be expected in the catalytic domains responsible for peptidase activity.

A comparative analysis should examine:

  • Sequence conservation, particularly in catalytic domains

  • Protein topology and membrane association patterns

  • Substrate specificity determinants

The T. melanosporum genome contains numerous genes with significant homology to genes in other ascomycetes, with identity percentages often ranging from 45-65% for conserved proteins . SEC11 would likely follow similar patterns of conservation, with higher homology in functional domains.

Functional conservation could be assessed through complementation studies, where T. melanosporum SEC11 would be expressed in yeast SEC11 mutants to determine if it can rescue the lethal phenotype associated with SEC11 deletion in yeast. This approach would establish whether the truffle protein can functionally substitute for its yeast counterpart despite potential structural differences.

What unique features of T. melanosporum SEC11 might be related to its ecological niche as a truffle-forming fungus?

T. melanosporum's ecological niche as a truffle-forming ectomycorrhizal fungus may be reflected in unique features of its SEC11 protein. While the core catalytic function would be conserved, adaptations might exist in substrate specificity or regulatory domains to accommodate the specific protein secretion needs of truffle biology.

Potential unique features might include:

  • Adaptations for processing proteins involved in the formation of hypogeous (underground) fruit bodies

  • Modifications for functioning in the fluctuating temperature and moisture conditions of soil environments

  • Specializations for processing proteins involved in melanin synthesis, which is important for truffle development and differentiation

  • Regulatory elements responsive to conditions that trigger fruit body formation

T. melanosporum undergoes distinct developmental transitions, including the formation of sterile and fertile veins, followed by ascospore development and melanization . These processes involve tissue-specific protein expression and secretion, potentially requiring specialized SEC11 activity or regulation compared to non-fruiting fungi.

Comparative genomic analyses focusing on SEC11 sequence variations among different truffle species versus non-truffle-forming fungi could reveal adaptations specific to the truffle lifestyle.

How do expression patterns of SEC11 differ between T. melanosporum and other model fungi during developmental transitions?

Expression patterns of SEC11 during developmental transitions likely differ between T. melanosporum and model fungi like Saccharomyces cerevisiae or Neurospora crassa due to their distinct life cycles. While specific SEC11 expression data for T. melanosporum is not provided in the search results, general patterns of gene expression during truffle development can inform hypotheses.

In T. melanosporum, fruit body development proceeds through six distinct stages, with significant gene expression changes occurring between stages . Many genes show stage-specific expression patterns, particularly during the transition from vegetative growth to reproductive development. For example, genes related to programmed cell death show differential expression patterns across developmental stages, with some increasing in expression at stage 6 (pigmented stage) while others decrease .

In contrast, model yeasts like S. cerevisiae undergo simpler developmental transitions, primarily between vegetative growth and sporulation. SEC11 in yeast is constitutively expressed as an essential gene , without the complex developmental regulation expected in truffle-forming fungi.

A comparative transcriptomic approach examining SEC11 expression across developmental stages in multiple fungal species would reveal:

  • Whether T. melanosporum SEC11 shows stage-specific regulation absent in simpler fungi

  • If SEC11 expression correlates with periods of intensive secretory activity during fruit body formation

  • Potential co-expression patterns with other genes involved in protein secretion and processing

Quantitative methodologies like those used for mycelial abundance measurement in truffles could be adapted for comparative expression analysis across species.

What are the best approaches for purifying active recombinant T. melanosporum SEC11 protein?

Purifying active recombinant T. melanosporum SEC11 presents challenges due to its nature as a membrane-associated component of the signal peptidase complex. Based on successful approaches with similar proteins, the following protocol is recommended:

  • Expression system selection:

    • Eukaryotic expression systems (P. pastoris or S. cerevisiae) are preferred over bacterial systems to ensure proper folding and post-translational modifications

    • Expression constructs should include a cleavable affinity tag (His6 or Strep-tag II) for purification

  • Membrane protein extraction:

    • Gentle cell lysis using glass beads or enzymatic methods

    • Membrane fraction isolation via differential centrifugation

    • Solubilization using mild detergents (DDM, LMNG, or GDN) that maintain native conformation

  • Purification strategy:

Purification StepConditionsPurpose
Affinity chromatographyNi-NTA or Strep-Tactin resin with 0.05% detergentInitial capture
Size exclusion chromatographySuperdex 200 in buffer with detergent below CMCRemove aggregates
Ion exchangeResource Q/S column (optional)Further purification
  • Activity verification:

    • In vitro signal peptide cleavage assay using fluorescent peptide substrates

    • Circular dichroism to confirm proper secondary structure

    • Thermal shift assays to assess protein stability

Throughout purification, it's critical to maintain conditions that preserve the native conformation of SEC11, including appropriate pH (typically 7.0-7.5), ionic strength, and presence of stabilizing agents such as glycerol (10-15%).

For structural studies, reconstitution into nanodiscs or amphipols may be considered as alternatives to detergent solubilization, potentially better preserving the native conformation and activity.

What assays can be developed to measure T. melanosporum SEC11 peptidase activity in vitro?

Developing robust assays for measuring T. melanosporum SEC11 peptidase activity is essential for functional characterization. Several complementary approaches can be employed:

  • Fluorogenic peptide substrate assay:

    • Design synthetic peptides containing a T. melanosporum signal sequence with a fluorophore-quencher pair flanking the cleavage site

    • Cleavage by SEC11 separates the fluorophore from the quencher, resulting in increased fluorescence

    • Measure kinetic parameters (Km, Vmax) under various conditions

  • Mass spectrometry-based assay:

    • Incubate recombinant SEC11 with synthetic signal peptide substrates

    • Analyze reaction products by LC-MS/MS to identify precise cleavage sites

    • Quantify substrate and product peaks to determine reaction rates

  • In vitro translation/translocation system:

    • Develop a cell-free system combining T. melanosporum microsomes with translation machinery

    • Monitor processing of radiolabeled nascent polypeptides

    • Compare wild-type versus mutant SEC11 activity

  • Reconstituted signal peptidase complex assay:

    • Co-express and purify all components of the T. melanosporum signal peptidase complex

    • Assess activity of the complete complex versus individual subunits

    • This approach would parallel studies in yeast where both SEC11p and SPC3p were found essential for signal peptidase activity

Each assay should include appropriate controls such as:

  • Heat-inactivated enzyme

  • Inhibitors of serine proteases (e.g., PMSF)

  • Substrates with mutated cleavage sites

These complementary approaches would provide comprehensive characterization of T. melanosporum SEC11 enzymatic properties, substrate preferences, and regulatory mechanisms.

What are the methodological challenges in studying SEC11 function in T. melanosporum and how can they be addressed?

Studying SEC11 function in T. melanosporum presents several methodological challenges due to the organism's unique biology. These challenges and potential solutions include:

  • Challenge: Genetic manipulation difficulties

    • Solution: Develop optimized transformation protocols using Agrobacterium-mediated transformation

    • Alternative: Use heterologous expression in more genetically tractable fungal systems followed by functional complementation tests

  • Challenge: Slow growth and complex lifecycle

    • Solution: Establish in vitro systems focusing on specific developmental stages

    • Alternative: Use real-time PCR for rapid quantification of gene expression, similar to methods used for mycelial abundance studies

  • Challenge: Obtaining sufficient biomass for biochemical studies

    • Solution: Optimize liquid culture conditions for mycelial growth

    • Alternative: Develop enrichment protocols for specific truffle tissues expressing SEC11

  • Challenge: Distinguishing SEC11 function from broader cellular effects

    • Solution: Use conditional expression systems or inducible RNAi

    • Alternative: Employ specific inhibitors of signal peptidase activity with careful controls

  • Challenge: Maintaining physiological relevance in vitro

    • Solution: Develop co-culture systems with host plant roots to study SEC11 in symbiotic context

    • Alternative: Use native protein extraction methods that preserve protein complexes

  • Challenge: Lack of established functional assays for truffle SEC11

    • Solution: Adapt assays from model systems with appropriate modifications

    • Alternative: Develop novel assays based on T. melanosporum-specific substrates identified through proteomic approaches

By combining multiple approaches and adapting methodologies from both model fungi and truffle-specific research, these challenges can be addressed to gain insights into SEC11 function in T. melanosporum biology, particularly its roles in fruit body development and symbiotic relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.