Recombinant Tupaia glis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tupaia glis (Tree shrew)
Target Names
Target Protein Sequence
MAYPLQLGFQDASSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEELTFDS YMIPTLDLKPGDVRLLEVDNRVVLPMEIPVRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLISTRPGLFYGQCSEICGSNHSFMPIVLELVPLKHFENWTTTML
Uniprot No.

Target Background

Function

Recombinant Tupaia glis Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme a (subunit 1) to the active site (subunit 1). This active site is a binuclear center (BNC) comprised of heme a3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 and what role does it play in cellular respiration?

Cytochrome c oxidase subunit II (COX II) is one of the core components of mitochondrial Cytochrome c oxidase (Cco), the terminal enzyme in the electron transport chain. It contains a dual core CuA active site and plays a crucial role in cellular respiration by catalyzing the reduction of molecular oxygen to water while simultaneously using the released energy to pump protons across the inner mitochondrial membrane. This process is fundamental to cellular energy production through oxidative phosphorylation. COX II specifically functions as an electron acceptor from cytochrome c and transfers these electrons to the catalytic center of the enzyme complex .

What are the molecular characteristics of recombinant tree shrew MT-CO2?

While exact specifications for Tupaia glis MT-CO2 are not fully detailed in the provided sources, inferences can be made from related cytochrome c oxidase studies. Based on similar proteins, recombinant MT-CO2 likely has a molecular weight in the range of 25-30 kDa before addition of any fusion tags. When expressed with common fusion tags (such as 6-His), the apparent molecular weight on SDS-PAGE may increase to approximately 40-45 kDa . The protein typically maintains a slightly acidic to neutral isoelectric point (pI) around 6.0-7.0, allowing for efficient purification using ion exchange chromatography methods .

What expression systems are most effective for producing recombinant MT-CO2?

For successful expression of functional MT-CO2, bacterial systems using E. coli have proven effective for similar cytochrome oxidase subunits. The pET expression system, particularly pET-32a, provides robust expression when induced with IPTG (isopropyl β-d-thiogalactopyranoside) in E. coli strains optimized for protein expression such as Transetta (DE3) . For enhanced solubility and proper folding, expression at lower temperatures (16-25°C) after induction is recommended. Alternative expression systems such as yeast or insect cells may provide better post-translational modifications but at the cost of lower yield compared to bacterial systems. The choice of expression system should be guided by the specific experimental requirements, particularly whether native conformation or high yield is prioritized .

What are the optimal purification strategies for recombinant Tupaia glis MT-CO2?

Purification of recombinant MT-CO2 is most efficiently achieved through affinity chromatography when the construct includes a fusion tag. For 6×His-tagged proteins, immobilized metal affinity chromatography using Ni²⁺-NTA agarose resin has shown excellent results, allowing single-step purification with good purity (>95%) . The purification protocol typically includes:

  • Cell lysis under native conditions (preferably with non-ionic detergents)

  • Binding to Ni²⁺-NTA resin in buffer containing 10-20 mM imidazole

  • Washing with increasing imidazole concentrations (20-50 mM)

  • Elution with 250-300 mM imidazole

For applications requiring tag removal, incorporating a protease cleavage site between the tag and protein allows subsequent purification steps. Size exclusion chromatography as a polishing step can further enhance purity and ensure proper oligomeric state .

What crystallization methods are suitable for obtaining high-resolution structures of recombinant MT-CO2?

While specific crystallization protocols for Tupaia glis MT-CO2 are not detailed in the provided sources, insights can be drawn from successful approaches with related cytochrome c oxidase proteins. Serial femtosecond crystallography has proven particularly valuable for obtaining high-resolution structures of cytochrome c oxidase proteins at room temperature, which avoids potential artifacts introduced by cryogenic conditions . For microcrystal preparation, techniques involving:

  • Controlled nucleation through seeding approaches

  • Optimization of precipitant composition (typical precipitants include PEG 400-4000)

  • Vapor diffusion methods (hanging or sitting drop) with protein concentrations of 10-15 mg/mL

  • Addition of specific detergents (such as dodecyl maltoside) to stabilize membrane protein components

For X-ray Free Electron Laser (XFEL) studies, producing large quantities of highly diffracting microcrystals is essential, and this can be achieved through batch crystallization methods optimized for volume and crystal size distribution .

How can room-temperature structural studies benefit the understanding of MT-CO2 function?

Room-temperature structural studies provide significant advantages over cryogenic approaches, particularly for mechanistically important proteins like cytochrome c oxidase. As demonstrated with ba3-type cytochrome c oxidase, room-temperature structures obtained through methods like serial femtosecond crystallography can resolve controversial findings from cryogenic studies .

Specific benefits include:

  • Elimination of radiation damage artifacts that may alter the coordination chemistry at metal centers

  • Preservation of physiologically relevant protein dynamics and conformational states

  • More accurate representation of active site ligands, which is particularly critical for understanding the oxygen reduction mechanism

  • Better resolution of water molecules and proton pathways essential for understanding the proton pumping mechanism

For MT-CO2 specifically, room-temperature structures could provide clearer insights into the CuA active site coordination and the structural basis for electron transfer from cytochrome c to the catalytic center .

What assays are most reliable for measuring the enzymatic activity of recombinant MT-CO2?

The enzymatic activity of recombinant MT-CO2 can be assessed through several complementary approaches:

  • Spectrophotometric assays: UV-visible spectrophotometry offers a straightforward approach to measuring the oxidation of reduced cytochrome c, with activity monitored as a decrease in absorbance at 550 nm . This assay should be performed in appropriate buffer systems (typically phosphate buffer at pH 7.2-7.4) with controlled temperature (25-37°C).

  • Oxygen consumption measurements: Using oxygen-sensitive electrodes (Clark-type electrodes) or optical sensors to directly measure the consumption of oxygen during the catalytic cycle provides a functional readout of activity.

  • Electron transfer kinetics: Stopped-flow spectroscopy can determine electron transfer rates between cytochrome c and the recombinant MT-CO2, providing insights into the efficiency of the initial electron acceptance step.

For all assays, it's essential to include appropriate controls, such as heat-inactivated enzyme or known inhibitors, to validate the specificity of the measured activity .

How can the interaction between recombinant MT-CO2 and potential inhibitors be characterized?

Characterization of interactions between recombinant MT-CO2 and potential inhibitors can be approached through multiple complementary methods:

  • Enzyme inhibition assays: Measuring activity in the presence of varying inhibitor concentrations allows determination of inhibition constants (Ki) and inhibition mechanisms (competitive, non-competitive, or uncompetitive).

  • Molecular docking: Computational approaches can predict binding modes and affinities of small molecules to MT-CO2, as demonstrated with allyl isothiocyanate (AITC) binding to COXII, where a sulfur atom formed a 2.9 Å hydrogen bond with Leu-31 .

  • Spectroscopic methods: Changes in the UV-visible or infrared spectral properties of MT-CO2 upon inhibitor binding can provide insights into the nature of the interaction and potential conformational changes induced.

  • Thermal shift assays: Differential scanning fluorimetry can assess the impact of inhibitors on protein thermal stability, often correlating with binding affinity.

  • Direct binding measurements: Isothermal titration calorimetry or surface plasmon resonance can provide quantitative binding parameters including affinity constants, stoichiometry, and thermodynamic profiles .

What insights can Tupaia glis MT-CO2 provide into the evolution of mitochondrial proteins?

Tupaia glis (tree shrew) occupies a unique phylogenetic position, having diverged from the primate order and classified in a separate taxonomic group (Scandentia). This positioning makes its mitochondrial proteins, including MT-CO2, valuable for evolutionary studies . Tree shrew proteins typically show higher sequence homology to primate counterparts compared to rodents, with human similarities often reaching approximately 85% versus 75% for rodents .

Specific insights that can be gained include:

  • Identification of conserved functional domains across evolutionary diverse species

  • Understanding the rate of molecular evolution in mitochondrial versus nuclear-encoded components of the respiratory chain

  • Characterization of species-specific adaptations that might relate to metabolic requirements or environmental pressures

  • Mapping the evolution of protein-protein interaction interfaces, particularly for interactions with cytochrome c

Comparative studies of tree shrew MT-CO2 with other species can help distinguish between core functional elements maintained through purifying selection and regions that have undergone adaptive evolution .

How does the structure of Tupaia glis MT-CO2 compare to bacterial and human cytochrome c oxidase subunits?

While detailed structural comparisons specific to Tupaia glis MT-CO2 are not provided in the search results, general evolutionary patterns observed in cytochrome c oxidase subunits can be informative. Studies of ba3-type versus aa3-type cytochrome c oxidase reveal significant structural differences particularly around the proton-loading site, despite conservation of core catalytic functions .

For mammalian proteins like those from Tupaia glis, we would expect:

These comparative insights can inform the design of experiments involving heterologous expression systems or the development of species-specific antibodies for research applications .

How can recombinant MT-CO2 be utilized in drug discovery targeting mitochondrial disorders?

Recombinant MT-CO2 offers significant potential for drug discovery applications targeting mitochondrial disorders, particularly those involving cytochrome c oxidase deficiency:

  • High-throughput screening platform: Purified recombinant MT-CO2 can serve as a target for screening compound libraries to identify molecules that modulate its activity or restore function to mutated variants.

  • Structure-based drug design: With crystallographic data, rational design of small molecules targeting specific sites on MT-CO2 becomes possible. The CuA binding site or protein-protein interaction interfaces are particularly promising targets.

  • Allosteric modulator discovery: As demonstrated with allyl isothiocyanate (AITC) affecting COXII activity, screens can identify compounds that bind at allosteric sites to influence protein function .

  • Development of pharmacological chaperones: For mutations that affect protein folding or stability, recombinant protein systems can help identify molecules that stabilize the native conformation.

  • Biomarker development: Antibodies raised against recombinant MT-CO2 can be used to develop assays for quantifying protein levels in patient samples, potentially serving as biomarkers for disease progression or treatment response.

The tree shrew model, being evolutionarily closer to primates than rodents, provides an advantageous system for validating findings before transitioning to human studies .

What are the challenges and solutions in studying protein-protein interactions involving MT-CO2?

Investigating protein-protein interactions involving MT-CO2 presents several technical challenges, particularly due to its integration within the larger cytochrome c oxidase complex:

Challenges:

  • Maintaining native conformation of the isolated subunit

  • Preserving interaction-competent states during purification

  • Distinguishing specific from non-specific interactions

  • Accounting for membrane environment effects on interaction dynamics

  • Capturing transient or weak interactions that may be functionally significant

Solutions and Approaches:

  • Co-purification techniques: Expressing MT-CO2 with potential interaction partners and using tandem affinity purification to isolate intact complexes.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometric analysis can capture even transient interactions and provide spatial constraints for modeling.

  • Surface plasmon resonance or bio-layer interferometry: These techniques can measure binding kinetics between MT-CO2 and partner proteins under controlled conditions.

  • Nanodiscs or liposome reconstitution: Incorporating purified MT-CO2 into lipid environments that better mimic the native membrane context for interaction studies.

  • FRET-based assays: Fluorescently labeled MT-CO2 and partner proteins can reveal interaction dynamics in real-time and potentially in living cells.

  • Hydrogen-deuterium exchange mass spectrometry: This approach can map interaction interfaces by identifying regions protected from exchange upon complex formation .

What strategies can address poor expression or insolubility of recombinant MT-CO2?

Poor expression or insolubility issues with recombinant MT-CO2 are common challenges that can be addressed through several targeted strategies:

  • Optimization of expression conditions:

    • Lower induction temperature (16-20°C) to slow folding and prevent aggregation

    • Reduced IPTG concentration (0.1-0.5 mM) for more controlled expression rate

    • Extended expression time (overnight to 24 hours) at lower temperatures

    • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Construct optimization:

    • Testing different fusion tags (MBP, SUMO, or Thioredoxin for enhanced solubility)

    • Optimization of codon usage for the expression host

    • Truncation constructs to remove hydrophobic regions while maintaining functional domains

    • Addition of solubilizing mutations identified through sequence alignment with soluble homologs

  • Solubilization approaches:

    • Inclusion of mild detergents (0.1-1% Triton X-100, n-Dodecyl β-D-maltoside)

    • Addition of stabilizing additives (5-10% glycerol, 100-250 mM NaCl, 5-10 mM reducing agents)

    • Extraction from inclusion bodies using urea or guanidinium followed by refolding protocols

  • Alternative expression systems:

    • Testing different E. coli strains (Rosetta, Arctic Express, SHuffle)

    • Considering eukaryotic expression systems for complex proteins requiring post-translational modifications

How can the functional integrity of purified recombinant MT-CO2 be validated?

Confirming the functional integrity of purified recombinant MT-CO2 is essential before proceeding with downstream applications. Multiple complementary approaches should be employed:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to confirm characteristic absorption spectra associated with correctly folded cytochrome oxidase components

    • Circular dichroism to assess secondary structure content and proper folding

    • Fluorescence spectroscopy to monitor tertiary structure and potential cofactor binding

  • Activity assays:

    • Cytochrome c oxidation assays using UV-spectrophotometer measuring decrease in absorbance at 550 nm

    • Oxygen consumption measurements using Clark-type electrodes or optical sensors

    • Enzyme kinetic analysis to determine Km and Vmax values and compare with literature values

  • Structural integrity:

    • Size exclusion chromatography to confirm proper oligomeric state

    • Limited proteolysis to assess compact folding (correctly folded proteins show resistance to limited digestion)

    • Thermal shift assays to determine melting temperature as an indicator of stability

  • Ligand and inhibitor binding:

    • Response to known inhibitors at expected IC50 values

    • Binding of known substrates or cofactors with characteristic spectroscopic changes

    • Computational validation through molecular dynamics simulations to assess structural stability

How can advanced imaging techniques enhance our understanding of MT-CO2 localization and dynamics?

Advanced imaging techniques are transforming our ability to study the localization, dynamics, and interactions of mitochondrial proteins like MT-CO2 in their native cellular context:

  • Super-resolution microscopy approaches:

    • Stimulated emission depletion (STED) microscopy can resolve MT-CO2 distribution within mitochondrial cristae structures

    • Single-molecule localization microscopy (PALM/STORM) enables tracking of individual MT-CO2 molecules within membranes

    • Structured illumination microscopy (SIM) provides detailed views of mitochondrial subcompartmentalization

  • Live-cell dynamics:

    • FRAP (Fluorescence Recovery After Photobleaching) can measure MT-CO2 mobility within the inner mitochondrial membrane

    • Single-particle tracking using quantum dots or other bright fluorophores reveals diffusion characteristics

    • Optogenetic approaches allow controlled perturbation of MT-CO2 function in specific mitochondrial subpopulations

  • Correlative microscopy:

    • Correlative Light and Electron Microscopy (CLEM) bridges the resolution gap between fluorescence localization and ultrastructural context

    • Cryo-electron tomography of labeled mitochondria reveals the native arrangement of respiratory complexes

  • Biosensor integration:

    • Fusion of MT-CO2 with fluorescent biosensors can report on local environmental conditions (pH, membrane potential)

    • FRET-based reporters integrated with MT-CO2 can monitor conformational changes during catalytic cycles

These advanced imaging approaches can be particularly valuable when studying Tupaia glis models, which offer closer physiological relevance to human systems than traditional rodent models .

What is the potential role of MT-CO2 in neurodegenerative diseases and aging processes?

The potential role of MT-CO2 in neurodegenerative diseases and aging processes represents an important frontier in mitochondrial research:

  • Neurodegenerative disease connections:

    • Mitochondrial dysfunction is implicated in Alzheimer's, Parkinson's, and Huntington's diseases

    • MT-CO2 mutations or dysfunctions may contribute to reduced ATP production, increased oxidative stress, and apoptotic signaling

    • Studies in tree shrews, with their closer evolutionary relationship to primates, may provide more translatable insights than rodent models

  • Aging-related mitochondrial changes:

    • Age-associated decline in cytochrome c oxidase activity correlates with reduced energy production capacity

    • MT-CO2 may undergo post-translational modifications with age that affect its function

    • Research in tree shrews has shown dynamic changes in DNA methylation during aging, suggesting epigenetic regulation may influence mitochondrial gene expression

  • Oxidative damage accumulation:

    • MT-CO2, as part of the electron transport chain, is exposed to reactive oxygen species

    • Cumulative oxidative damage to MT-CO2 may contribute to respiratory chain dysfunction

    • Tree shrew models allow for longitudinal studies of age-related changes in mitochondrial function

  • Therapeutic targeting possibilities:

    • Small molecules that enhance MT-CO2 stability or function could have neuroprotective effects

    • Gene therapy approaches targeting MT-CO2 may help address mitochondrial dysfunction

    • Recombinant MT-CO2 could serve as a platform for screening compounds that preserve function during aging

Understanding these processes in Tupaia glis models offers advantages due to their closer biological similarity to humans and longer lifespan compared to rodents, providing a valuable intermediate model between rodents and primates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.