Recombinant Turkey astrovirus 1 Non-structural polyprotein 1AB (ORF1)

Shipped with Ice Packs
In Stock

Description

Genomic Context

  • ORF1 Organization: The TAstV-1 genome contains three open reading frames (ORFs). ORF1a and ORF1b encode non-structural proteins, while ORF2 encodes the capsid protein .

  • Polyprotein 1AB: ORF1ab is produced via ribosomal frameshifting between ORF1a and ORF1b, generating a precursor cleaved into functional subunits (e.g., protease p27, transmembrane protein 1A) .

Key Domains

Domain/RegionFunctionPosition (AA)
Serine protease p27Cleaves polyprotein precursors410–655
RdRpRNA replication and transcription1028–1611

Production System

  • Host: Escherichia coli .

  • Tag: N-terminal His tag for affinity chromatography .

  • Purity: >90% (validated via SDS-PAGE) .

Physical Properties

ParameterDetail
Molecular Weight~70 kDa (calculated from 584 AA)
Storage BufferTris/PBS-based buffer, 6% Trehalose
ReconstitutionSterile water (0.1–1.0 mg/mL)

Applications in Research

  1. Viral Replication Studies: Used to investigate protease and RdRp mechanisms in astrovirus replication .

  2. Antiviral Drug Screening: Serves as a target for inhibitors targeting viral enzymatic activity .

  3. Antibody Development: Immunogen for generating antibodies against TAstV-1 .

Comparative Analysis with Other Astrovirus Polyproteins

FeatureTAstV-1 ORF1AB Human Astrovirus ORF1AB Ovine Astrovirus ORF1AB
HostTurkeyHumanSheep
Protease ActivityConfirmed (p27 domain)Confirmed (p27 domain)Confirmed (p27 domain)
RdRp MotifConserved (GDD motif)Conserved (GDD motif)Conserved (GDD motif)
Expression SystemE. coliMammalian cellsE. coli/Baculovirus

Research Findings and Challenges

  • Cleavage Sites: TAstV-1 ORF1AB undergoes autocatalytic processing at residues 410 and 655, similar to human astrovirus nsP1a .

  • Stability Issues: Lyophilization preserves activity, but repeated freeze-thaw cycles degrade the protein .

  • Cross-Species Insights: Structural homology with mammalian astroviruses suggests conserved replication mechanisms .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve 3D structures of RdRp and protease domains.

  • Host-Pathogen Interactions: Role of ORF1AB in evading avian immune responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF1; Non-structural polyprotein 1AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1028-1611
Protein Length
Full Length of Mature Protein
Species
Turkey astrovirus 1 (TAstV-1)
Target Names
ORF1
Target Protein Sequence
QRKKTCRTCGETRPHNHKMCRDRHTRRFCFWCGVVHSDVEGHSRDLKCPKCSAGFANLRE MEQHAVTTCSKKLDSHPEPSRVFQPLDFGLGIFDWRFDLQPIRHHVAVPMNVEVLGYIPV DRLVERRNVITDPLLKLVEPWRQETYGPAVWTIKAYNKMFEKFFYSEPLEFAQLDSSILN LADSYCLQEHDYMSGSQIVPITSTEKNLDSTPGYPKFKVFSTEREYLSTCGWDEYKTVWQ VGPREKPLWWCFLKTEVLKLAKIEQDDIRMILCTDPVFTRIGAAFEQHQNSLMKLETENH HAQVGWSPFFGGIHRRATRLYGEHRYYVELDWTRFDGTIPPELFRRIKLMRFFLLDPKYK TPENRDRYNWYVENLIDKVVLLPTGEVCKIYGGNPSGQFSTTVDNNFVNVWLTVFELAYL FYKEHNRLPTICEIKKHTDWICYGDDRLLAVDKRFINSYDTAAVIAMYKDVFGMWVKPDN IKVFPSLEGVSFCGMVWTKRKGQYVGKPNVDKILSTLSDPVSRLPDIQSLWGKLVSLRLL CENESDEVVDYLDKQIESVSRHAKEAGIALPKIGPDFYAEIWID
Uniprot No.

Target Background

Function
This protein encompasses the viral protease responsible for polyprotein cleavage into functional units. It also includes functionalities essential for genomic RNA replication and subgenomic mRNA transcription; the protein is covalently linked to the 5' end of genomic and subgenomic RNAs.
Protein Families
Astroviridae polyprotein 1AB family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Turkey astrovirus 1 (TAstV-1) and how does it differ genetically from TAstV-2?

Turkey astrovirus (TAstV) was first described in 1980 in the United Kingdom, with the first United States isolate identified in 1985. TAstV-1 represents the original isolate, while TAstV-2 was isolated later in 1996 and is antigenically and genetically distinct from TAstV-1. TAstV-2 has been more extensively characterized, with the complete genome of the prototype NC/96 strain available .

Methodologically, the differentiation between these types involves:

  • Sequence analysis of both the polymerase (ORF1b) and capsid (ORF2) genes

  • Serological testing with type-specific antibodies

  • Phylogenetic analysis using reference sequences

Genetic differences between TAstV-1 and TAstV-2 are substantial, with sequence identity showing high variability. Within TAstV-2 isolates alone, capsid gene sequence identity can be as low as 69%, while the polymerase gene is more conserved (86-99% identity) . Researchers should consider these variations when designing primers and selecting reference sequences for phylogenetic analyses.

What are the structural characteristics and functional domains of TAstV non-structural polyprotein 1AB (ORF1)?

The non-structural polyprotein 1AB of astroviruses contains multiple functional domains that require proteolytic processing to generate mature proteins. Based on comparative analysis with other astroviruses, TAstV ORF1 likely contains:

  • Methyltransferase domain (N-terminal region)

  • Protease domain (viral protease for polyprotein processing)

  • RNA-dependent RNA polymerase (RdRp) in the ORF1b region

  • VPg (viral protein genome-linked) domain

  • NTPase/helicase domains

Methodologically, researchers can identify these domains through:

  • Sequence alignment with characterized astrovirus proteins

  • Motif analysis using conserved domain databases

  • Homology modeling based on solved structures of related viral proteins

  • Functional assays of expressed protein fragments

The polymerase domain in ORF1b is particularly conserved among astroviruses and represents a reliable region for phylogenetic analysis, with a 17% nucleotide sequence distance cut-off effectively distinguishing established species .

What expression systems are most suitable for producing recombinant Turkey astrovirus proteins?

Selection of an appropriate expression system depends on research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, simple setup, cost-effectiveLimited post-translational modifications, potential protein insolubilitySmall proteins, enzymatic domains
Insect cells (Baculovirus)Eukaryotic processing, better foldingModerate cost, more complex setupFull polyprotein, structural studies
Mammalian cellsAuthentic post-translational modificationsLower yield, expensiveProtein-protein interactions, functional studies
Cell-free systemsRapid expression, toxic protein expressionLow yield, expensive reagentsInitial screening, difficult-to-express proteins

Methodological approach:

  • Clone the gene of interest with appropriate purification tags

  • Optimize codon usage for the expression host

  • Test expression conditions (temperature, induction time, media)

  • Verify protein identity by Western blot and mass spectrometry

  • Assess protein folding through enzymatic activity assays or structural analyses

For enzymatically active proteins like the RdRp domain, functional assays should be conducted to ensure proper folding in the chosen expression system.

How can researchers design and optimize experiments to characterize polyprotein processing in TAstV?

The study of polyprotein processing requires a systematic approach:

  • Construct Design: Create constructs containing the complete polyprotein or segments with multiple cleavage sites

  • Protease Co-expression: Express viral protease separately or as part of the polyprotein

  • Time-course Experiments: Monitor processing over time (similar to the approach used for SARS-CoV-2 in search result )

  • Cleavage Site Mutations: Introduce mutations at predicted cleavage sites to confirm their functionality

  • Mass Spectrometry Analysis: Identify cleavage products and verify authentic N- and C-termini

A methodological workflow includes:

  • Express the polyprotein in an appropriate system

  • Collect samples at defined time intervals (0, 0.5, 1, 2, 4, 8, 24 hours)

  • Analyze by SDS-PAGE to visualize processing intermediates

  • Confirm protein identities by in-gel tryptic digestion and LC-MS/MS

  • Use authentic N- and C-terminal peptide detection to verify correct processing

  • Consider temperature variation (e.g., 4°C vs. 37°C) to slow processing for better observation of intermediates

This approach has been successfully applied to coronavirus polyprotein processing and can be adapted for TAstV studies .

What methodologies can detect and characterize recombination events in Turkey astrovirus ORF1?

Recombination is a critical evolutionary mechanism in astroviruses, including TAstVs. Several complementary approaches can be used to identify recombination events:

  • Phylogenetic Analysis of Different Genome Regions:

    • Amplify and sequence multiple regions (ORF1a, ORF1b, ORF2)

    • Construct separate phylogenetic trees for each region

    • Compare tree topologies to identify incongruences suggesting recombination

  • Similarity Plot Analysis:

    • Utilize programs like SimPlot to perform sliding window analysis

    • Plot sequence similarity across the genome compared to reference strains

    • Identify breakpoints where similarity patterns change

  • Statistical Recombination Detection Methods:

    • Implement algorithms such as RDP, GENECONV, Bootscan, or MaxChi

    • Apply multiple methods to increase confidence in detected events

    • Verify statistically significant recombination signals

  • Breakpoint Analysis:

    • Examine sequence conservation around putative breakpoints

    • Look for RNA structural elements that might facilitate recombination

    • Focus on the ORF1b/ORF2 junction, a known recombination hotspot in astroviruses

In TAstVs, recombination appears common based on differing topologies between polymerase and capsid gene phylogenetic trees . These events likely contribute to the high genetic diversity observed in field isolates, with significant implications for viral evolution and vaccine development.

How can researchers apply structural biology techniques to investigate TAstV polyprotein conformational dynamics?

Understanding the structural dynamics of viral polyproteins provides insights into processing mechanisms and potential drug targets. A comprehensive structural biology approach includes:

  • X-ray Crystallography:

    • Express and purify individual domains or processing intermediates

    • Optimize crystallization conditions for diffraction-quality crystals

    • Solve structures at high resolution to identify catalytic sites and protein interfaces

    • Example data parameters from a related structure study :

ParameterValue
Resolution1.87-3.20 Å
R-factor0.073-0.152
Space groupP1 or P41
Completeness89.2-96.3%

These approaches provide complementary structural information to build a comprehensive understanding of TAstV polyprotein structure and dynamics.

How do researchers investigate the interaction between TAstV polyprotein processing and host cell factors?

Viral polyprotein processing often involves interactions with host cell factors. To investigate these interactions:

  • Proteomics Approaches:

    • Perform pull-down assays with tagged viral proteins

    • Use proximity labeling methods (BioID, APEX) to identify transient interactors

    • Conduct comparative proteomics between infected and uninfected cells

    • Apply SILAC or TMT labeling for quantitative analysis

  • CRISPR Screening:

    • Develop reporter systems for polyprotein processing efficiency

    • Perform genome-wide or targeted CRISPR screens to identify host factors

    • Validate hits through individual gene knockout/knockdown

    • Assess the impact on viral replication and polyprotein processing

  • In vitro Reconstitution:

    • Express and purify polyprotein with viral protease

    • Add candidate host factors to processing reactions

    • Monitor changes in processing efficiency or specificity

    • Analyze by SDS-PAGE and mass spectrometry

  • Live-Cell Imaging:

    • Generate fluorescent protein fusions to visualize processing in real-time

    • Employ FRET-based sensors to detect cleavage events

    • Track subcellular localization of processing intermediates

    • Correlate with cellular stress responses or membrane rearrangements

Host factors might include chaperones that facilitate folding, cellular proteases that contribute to processing, or scaffolding proteins that organize viral replication complexes. Understanding these interactions could reveal new antiviral strategies.

What approaches can be used to study the impact of recombination on TAstV polyprotein function and viral fitness?

Recombination can significantly affect viral fitness through changes in protein function. To study these effects:

  • Reverse Genetics Approaches:

    • Generate recombinant viruses with defined genomic backgrounds

    • Introduce specific recombination events through molecular cloning

    • Assess replication kinetics in cell culture

    • Evaluate pathogenicity in animal models

  • Protein Function Assays:

    • Express chimeric proteins representing natural recombinants

    • Measure enzymatic activities (polymerase, protease)

    • Assess protein stability and proper folding

    • Determine substrate specificities for recombinant proteases

  • Competitive Fitness Assays:

    • Co-infect cells or animals with parental and recombinant viruses

    • Track relative proportions over multiple passages

    • Sequence viral populations to detect additional adaptations

    • Correlate fitness with specific genomic features

  • Evolutionary Analyses:

    • Collect field isolates representing diverse recombination patterns

    • Perform deep sequencing to identify minor variants

    • Apply selection pressure analyses (dN/dS ratios)

    • Correlate recombination patterns with host range or disease symptoms

Recombination in TAstVs appears to occur frequently at the ORF1/ORF2 junction, similar to other astroviruses . This pattern may reflect structural constraints or selective advantages for certain recombination types, with implications for vaccine design and viral evolution modeling.

What are the current challenges and solutions in developing high-throughput assays for TAstV polyprotein function?

Developing high-throughput assays presents several challenges:

  • Protein Expression Challenges:

    • Large polyproteins are difficult to express in full-length form

    • Proteolytic processing complicates purification of stable products

    • Enzymatic activities may require specific cofactors or conditions

    Solutions:

    • Express discrete functional domains rather than full polyprotein

    • Develop cell-free translation systems optimized for viral proteins

    • Use inducible self-cleaving protease domains to generate defined products

  • Assay Development Challenges:

    • Multiple enzymatic activities require different detection methods

    • RdRp activity assays often have high background

    • Processing kinetics may be slow, limiting throughput

    Solutions:

    • Develop fluorescence-based assays for protease activity

    • Use template-specific primers for RdRp activity detection

    • Implement time-resolved fluorescence for slow reactions

  • Data Analysis Challenges:

    • Complex processing pathways generate multiple intermediates

    • Distinguishing specific from non-specific inhibition

    • Correlating in vitro activity with in vivo relevance

    Solutions:

    • Apply machine learning for pattern recognition in processing profiles

    • Include counter-screens for compound selectivity

    • Validate hits in cell-based viral replication assays

  • Standardization Challenges:

    • Limited availability of reference materials

    • Variability between different viral strains

    • Lack of established positive controls for inhibition studies

    Solutions:

    • Create a repository of well-characterized constructs and proteins

    • Include multiple reference strains in assay development

    • Design peptide-based substrates for standardized protease assays

The development of robust assays for TAstV polyprotein function would accelerate basic research and potentially lead to the identification of antiviral candidates targeting essential viral enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.