Recombinant Turkey astrovirus 2 Non-structural polyprotein 1AB (ORF1)

Shipped with Ice Packs
In Stock

Description

Genomic Organization

TAstV-2 ORF1 encodes a 1,638-amino acid polyprotein (UniProt ID: Q9ILI5) with the following features:

  • Gene structure: Split into ORF1a (N-terminal) and ORF1b (C-terminal), linked by a ribosomal frameshift mechanism .

  • Domains: Contains conserved motifs for RNA helicase, serine protease, VPg (viral protein genome-linked), and transmembrane regions .

Table 1: Key domains in ORF1 polyprotein

DomainPosition (AA)Function
RNA helicase-like1-300Putative RNA unwinding activity
Serine protease450-600Polyprotein self-cleavage
VPg domain700-800Genome replication initiation
Transmembrane region900-1050Membrane association of RCs

Proteolytic Processing

The full-length 1AB polyprotein is cleaved into:

  1. p19: N-terminal regulatory protein

  2. Transmembrane protein 1A: Anchors replication complexes (RCs) to ER membranes

  3. Serine protease p27: Mediates polyprotein processing (EC 3.4.21.-)

  4. p20: RNA-binding protein with possible immune evasion roles

Expression Systems

The protein has been successfully expressed in:

  • E. coli (most common)

  • Yeast (Pichia pastoris)

  • Baculovirus/insect cell systems

Table 3: Comparative sequence identity (%)

RegionTAstV-2 vs CAstVTAstV-2 vs DAstV
ORF1a77.8-99.450.5-60.9
ORF1b86.2-98.158.4-69.7
ORF2<75<50

Research Applications

  1. Protease inhibitor screening: Used to test compounds targeting the conserved serine protease domain .

  2. Vaccine development: Serves as antigen for monoclonal antibody production (e.g., mouse IgG2a MAbs for lateral flow assays) .

  3. Evolutionary studies: Recombination analysis using ORF1 sequences helps track viral spread in poultry farms .

Challenges and Future Directions

While recombinant ORF1 polyproteins enable structural studies (cryo-EM efforts ongoing), limitations include:

  • Instability of full-length constructs requiring co-expression with chaperones .

  • Lack of robust cell culture systems for TAstV-2, necessitating reverse genetics approaches .

Current research focuses on:

  • Mapping protease cleavage sites using MS/MS .

  • Engineering thermostable mutants for vaccine formulations .

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF1; Non-structural polyprotein 1AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1052-1638
Protein Length
Full Length of Mature Protein
Species
Turkey astrovirus 2 (TAstV-2)
Target Names
ORF1
Target Protein Sequence
QRKPRACKWCGSSQKHDYRECRFQREKRFCVYCAAMHSMFEGHIRPIECTSCKKSFSGIE KLEDHVVSGECQKKLIEGPVTTKAPTPVPDWLKIFAWEDDILPPEGKTALPENVTLIGHI PVDKLVSRTKKVQDPLLGLVTPWKQDMYDSTTWTVKAYTKMFEKFHYHDPVDFVEQYAEF VLLCDNMVLREHDYMANSNITPIMSTEKNVNSTPAYPKFQAYDSEAEYLEDCGWQEYLDV VSDPETINRRPLWWCFLKNEVLKREKIEDSDIRMILCTDPIFTRIGAMFEQDQNNRMKQQ TEIRSAQVGWTPFFGGLDRRVRRLYGDGDRYFVEMDWTRYDGTIPKSLFWRIRQIRFFFL HDSHKTPKMRRLYNWYVKNLLEKIILLPTGEVCQVKKGNPSGQFSTTVDNNMINVWLTTF EVSYLFFKQRGRLPTEKELQENCSMICYGDDRLLSIRKGFVEYEPDTVIDMYKNIFGMWV KRNNIKIQDTPEGLSFCGLTIVKSSTGAYVGVPNVNKILSTLENPVRRLPDVESLWGKLV SLRILCENAPSNVKHFLDEQISNVEEFAARENIQLPEVGPDFYSRIW
Uniprot No.

Target Background

Function

This protein participates in the viral protease cleavage of the polyprotein into functional products. It also encompasses the activities required for genomic RNA replication and subgenomic mRNA transcription. The protein is covalently attached to the 5' end of both genomic and subgenomic RNAs.

Protein Families
Astroviridae polyprotein 1AB family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Turkey astrovirus 2 Non-structural polyprotein 1AB (ORF1)?

Turkey astrovirus 2 Non-structural polyprotein 1AB (ORF1) is a critical component of the viral genome that encodes multiple functional proteins essential for viral replication. The astrovirus genome typically contains three open reading frames (ORFs): ORF1a, ORF1b, and ORF2, with a frameshift structure between ORF1a and ORF1b . ORF1 encodes non-structural proteins including both a protease and an RNA-dependent RNA polymerase.

When processed, the Non-structural polyprotein 1AB is cleaved into multiple functional chains:

  • Protein p19

  • Transmembrane protein 1A

  • Serine protease p27

  • Protein p20

  • RNA-directed RNA polymerase

The full amino acid sequence contains multiple functional domains that contribute to viral replication, protein processing, and genome synthesis. From a genetic perspective, the ORF1b region of astroviruses appears to be the least divergent among different ORFs, suggesting evolutionary constraints on this functionally critical region .

How should researchers prepare and handle Recombinant Turkey astrovirus 2 Non-structural polyprotein 1AB?

For optimal experimental outcomes when working with Recombinant Turkey astrovirus 2 Non-structural polyprotein 1AB, researchers should follow these methodological guidelines:

  • Storage protocols:

    • Store the protein at -20°C for standard storage

    • For extended storage, maintain at -20°C or -80°C

    • Keep working aliquots at 4°C for up to one week maximum

    • Avoid repeated freezing and thawing cycles which can significantly impact protein activity

  • Handling procedures:

    • The protein is typically supplied in a stabilizing Tris-based buffer containing 50% glycerol

    • When designing experiments, account for buffer components that may affect assay conditions

    • Upon receipt, divide the protein into small working aliquots to minimize freeze-thaw cycles

    • Maintain the protein on ice during experimental procedures

  • Expression considerations:

    • The recombinant protein can be successfully expressed in bacterial systems such as E. coli

    • His-tagging is commonly used to facilitate purification, though tag type may vary depending on the production process

    • When expressing custom constructs, the sequence information available (UniProt: Q9ILI5) can guide design strategies

What expression systems are most effective for producing functional Recombinant Turkey astrovirus 2 Non-structural polyprotein 1AB?

When selecting an expression system for Recombinant Turkey astrovirus 2 Non-structural polyprotein 1AB, researchers should consider the experimental requirements and protein characteristics:

Bacterial expression systems (E. coli):

  • Most commonly used for recombinant astrovirus proteins as demonstrated in available products

  • Advantages: High yield, cost-effectiveness, scalability, rapid production timelines

  • Limitations: Lacks eukaryotic post-translational modifications, potential for inclusion body formation

  • Methodology: Optimize codon usage for bacterial expression, consider fusion tags for solubility enhancement, test multiple strains (BL21, Rosetta, etc.)

Insect cell expression systems:

  • Appropriate when mammalian-like post-translational modifications are required

  • Advantages: Better protein folding than bacterial systems, moderate cost, good for complex viral proteins

  • Limitations: Lower yields than bacterial systems, more technical expertise required

  • Methodology: Baculovirus expression vectors, Sf9 or High Five cells, optimize infection conditions

Mammalian expression systems:

  • Consider when authentic viral protein processing and folding are critical

  • Advantages: Native-like protein processing, appropriate for functional studies

  • Limitations: Highest cost, lowest yields, technically demanding

  • Methodology: HEK293 or CHO cells, transient or stable expression approaches

The choice of system should be guided by the intended application, with bacterial systems sufficient for antibody production but more complex systems potentially necessary for functional enzymatic studies of the protease or RNA-dependent RNA polymerase domains.

What methodologies are most effective for studying recombination events in Turkey astrovirus 2 involving ORF1?

Recombination events in astroviruses, including Turkey astrovirus 2, are important evolutionary mechanisms that contribute to viral diversity and adaptation. The following methodological approaches have proven effective for studying these events:

  • Comprehensive genomic sequencing and analysis:

    • Full genome sequencing is essential for identifying recombination events in astroviruses

    • Next-generation sequencing approaches provide the necessary coverage and depth

    • Multiple strains should be analyzed to identify patterns of recombination

  • Recombination detection algorithms and software:

    • SimPlot analysis can identify putative crossover points by comparing sequence similarity patterns along the genome

    • Programs like RDP4, GARD, and BOOTSCAN offer complementary approaches to confirm recombination sites

  • Strategic phylogenetic analysis:

    • Construct separate phylogenetic trees for different genomic regions (ORF1a, ORF1b, ORF2)

    • Incongruent tree topologies suggest recombination events

    • Maximum-likelihood methods with appropriate nucleotide substitution models (e.g., Tamura-Nei, General Time Reversible) and robust bootstrap support (1000 replicates) are recommended

  • Targeted analysis of recombination hotspots:

    • The ORF1b/ORF2 junction represents a preferential site for RNA crossover in astroviruses

    • Studies have identified five potential recombination sites in the astrovirus genome, with three near the conserved region between ORF1b and ORF2

    • Primers designed to flank these regions are particularly useful for identifying recombinants

  • Experimental verification of recombinants:

    • In vitro recombination assays to test hypotheses about recombination mechanisms

    • Reverse genetics approaches to create synthetic recombinants and evaluate their viability

    • Cell culture systems to study the replication efficiency of natural recombinants

How can researchers effectively analyze the protease activity of the Turkey astrovirus 2 Non-structural polyprotein 1AB?

Analysis of the serine protease activity within the Non-structural polyprotein 1AB requires specialized biochemical approaches:

  • Substrate design and cleavage assays:

    • Design synthetic peptides mimicking natural cleavage sites within the viral polyprotein

    • Incorporate fluorogenic or chromogenic groups for detection (e.g., pNA, AMC, FRET-based substrates)

    • Measure cleavage kinetics under varying conditions (pH, temperature, ionic strength)

    • Methodology: Spectrofluorometric or spectrophotometric monitoring of substrate processing in real-time

  • Protease domain expression and purification:

    • Express the serine protease p27 domain (identified in the polyprotein ) in isolation

    • Compare activity of isolated domain versus the full polyprotein context

    • Ensure proper folding through activity-based assays

    • Methodology: Size-exclusion chromatography to confirm monomeric state, circular dichroism to verify secondary structure

  • Inhibitor profiling and characterization:

    • Test class-specific protease inhibitors (e.g., PMSF, aprotinin for serine proteases)

    • Develop targeted inhibitors based on substrate sequences

    • Perform structure-activity relationship studies with modified inhibitors

    • Methodology: IC50 determination, inhibition kinetics (competitive, non-competitive, uncompetitive)

  • Mutagenesis studies:

    • Identify the catalytic triad through sequence alignment with other viral serine proteases

    • Create point mutations in putative active site residues

    • Assess impact on protease activity and polyprotein processing

    • Methodology: Site-directed mutagenesis, activity comparisons, SDS-PAGE analysis of processing

  • Structural characterization:

    • X-ray crystallography or cryo-EM studies of the protease domain

    • NMR for dynamic analysis of substrate binding

    • Computational modeling of enzyme-substrate interactions

    • Methodology: Protein crystallization trials, structural refinement, molecular dynamics simulations

These approaches can help elucidate the mechanism of action of the viral protease and potentially identify targets for antiviral intervention.

What are the challenges and strategies in studying the RNA-dependent RNA polymerase function of Turkey astrovirus 2 ORF1?

The RNA-dependent RNA polymerase (RdRp) encoded within ORF1 presents unique challenges for functional studies:

Key Challenges:

  • Protein expression and purification obstacles:

    • Obtaining sufficient quantities of active enzyme

    • Maintaining structural integrity and enzymatic activity during purification

    • Determining the minimal functional unit versus requirements for additional viral factors

  • Enzymatic activity assessment:

    • Designing appropriate template RNAs that mimic viral genomic elements

    • Distinguishing between de novo initiation and primer-dependent synthesis

    • Quantifying activity with sufficient sensitivity and specificity

  • Evolutionary considerations:

    • ORF1b (encoding part of the RdRp) is the least divergent among astrovirus ORFs

    • Balancing conserved mechanistic insights with virus-specific adaptations

    • Interpreting findings in the context of recombination events involving ORF1b

Methodological Strategies:

  • Protein engineering approaches:

    • Express the RdRp domain with flanking sequences that may contribute to function

    • Consider fusion constructs with solubility-enhancing tags

    • Engineer constructs based on known structures of related viral RdRps

    • Methodology: Rational construct design, thermal shift assays to optimize buffer conditions

  • In vitro polymerase assays:

    • Filter-binding assays with radiolabeled nucleotides

    • Real-time monitoring of RNA synthesis using fluorescent nucleotide analogs

    • PAGE analysis of RNA products to assess length and integrity

    • Methodology: Optimization of reaction conditions (metal ions, pH, temperature)

  • Template design considerations:

    • Construct templates containing authentic viral 3' termini

    • Compare homopolymeric versus virus-specific templates

    • Evaluate the impact of RNA secondary structures on polymerase activity

    • Methodology: In vitro transcription of defined templates, RNA folding prediction

  • Fidelity and error analysis:

    • Measure nucleotide misincorporation rates

    • Sequencing of synthesized RNA products to assess error frequencies

    • Competition assays with correct versus incorrect nucleotides

    • Methodology: Next-generation sequencing of products, single-nucleotide incorporation kinetics

These approaches can provide insights into the fundamental mechanisms of astrovirus genome replication and the specific adaptations in Turkey astrovirus 2.

How do mutations in the Non-structural polyprotein 1AB affect virus replication and pathogenicity?

Mutations in the Non-structural polyprotein 1AB can significantly impact viral fitness and disease outcomes through various mechanisms:

Understanding the complex effects of mutations requires full genomic analyses and functional studies . The relatively conserved nature of ORF1b across astroviruses suggests functional constraints that can guide the interpretation of naturally occurring or engineered mutations.

What techniques are most reliable for analyzing protein-protein interactions involving Turkey astrovirus 2 Non-structural polyprotein 1AB?

Investigating protein-protein interactions involving the Non-structural polyprotein 1AB requires a multi-faceted approach:

In vitro approaches:

  • Pull-down assays:

    • Express recombinant polyprotein with affinity tags

    • Immobilize on appropriate matrix and incubate with potential interaction partners

    • Identify bound proteins through mass spectrometry or western blotting

    • Methodology: Optimize binding and washing conditions to minimize non-specific interactions

  • Surface plasmon resonance (SPR):

    • Measure real-time binding kinetics and affinities

    • Quantitative assessment of association and dissociation rates

    • Evaluate effects of mutations on binding properties

    • Methodology: Immobilize one protein partner on sensor chip, flow analyte at varying concentrations

Cellular approaches:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion proteins express in relevant cell types

    • Identify proteins within nanometer-scale proximity to the polyprotein

    • Mass spectrometry analysis of biotinylated proteins

    • Methodology: Optimize labeling time, control for background biotinylation

  • Fluorescence-based interaction assays:

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in cells

    • Förster resonance energy transfer (FRET) for detecting proximal proteins

    • Fluorescence correlation spectroscopy for dynamic interaction studies

    • Methodology: Construct design with appropriate linkers, controls for non-specific assembly

Computational and structural approaches:

  • Molecular docking and simulation:

    • Predict interaction interfaces between the polyprotein and partners

    • Molecular dynamics simulations to assess stability of predicted complexes

    • Evaluation of electrostatic and hydrophobic contributions to binding

    • Methodology: Homology modeling when structures are unavailable, integration with experimental data

  • Structural studies of complexes:

    • Cryo-electron microscopy of purified complexes

    • X-ray crystallography of co-crystallized proteins

    • Cross-linking mass spectrometry to identify interaction sites

    • Methodology: Chemical cross-linkers of various lengths, MS/MS analysis of cross-linked peptides

When studying interactions involving the Non-structural polyprotein 1AB, it's critical to consider both the full polyprotein and its cleaved products, as processing significantly alters interaction potential. Additionally, viral replication complex formation may require multiple viral and host proteins, necessitating more complex experimental systems than binary interaction assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.