Recombinant Turkey enteric coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Turkey enteric coronavirus (TCoV) (TCV)
Target Names
M
Target Protein Sequence
MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMSVYVIKMIILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKVS HLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Gammacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of turkey coronavirus membrane (M) protein?

The turkey coronavirus (TCoV) membrane protein has a predicted size of 230 amino acids with a molecular weight (Mr) of 26K. Sequence analysis has revealed that the TCoV M protein contains a potential N-glycosylation site at the N terminus, situated at the same location as in bovine coronavirus (BCV), murine hepatitis virus (MHV), and transmissible gastroenteritis virus. The amino acid sequences of the TCoV M protein demonstrate more than 99% similarity to those published for BCV, indicating a very close genomic relationship between these coronaviruses . This high level of amino acid conservation suggests that BCV, TCoV, and human respiratory coronavirus strain OC43 (HCV-OC43) must have diverged from each other only recently.

How does the M protein of turkey coronavirus differ from other avian coronaviruses?

One of the structural differences observed between TCoV and BCV is the type of glycosylation of the M protein, which is both N- and O-glycosylated in these viruses . The M protein of TCoV shows extensive similarity with other coronaviruses, particularly 86% amino acid sequence identity with murine hepatitis virus (MHV) . When comparing TCoV with infectious bronchitis virus (IBV), phylogenetic analysis reveals that most TCoV strains form distinct clusters, though some recombinant strains have been identified that contain segments similar to IBV, particularly in the S gene region . This genetic relationship data is crucial for understanding the evolution and cross-species transmission potential of avian coronaviruses.

What expression systems are most effective for producing recombinant TCoV M protein?

While the search results don't specifically detail M protein expression systems, we can infer appropriate methodologies from successful expression of other TCoV structural proteins. For instance, the TCoV nucleocapsid (N) protein has been successfully expressed in Escherichia coli using the pGEX-4T3 vector system, which produces a GST fusion protein . In this system, the full-length N gene was amplified from TCoV, directionally cloned into BamHI and EcoRI restriction sites, and expressed as a GST fusion protein. The expressed protein was visualized as a 69/78-kDa doublet before thrombin cleavage, which then yielded a 43/52-kDa doublet .

A similar approach could be applied for M protein expression, with appropriate consideration for the membrane-associated nature of the protein. Baculovirus expression systems have also been used for coronavirus structural proteins and might be suitable for the M protein, particularly if post-translational modifications such as glycosylation are important for functional studies.

What purification strategies address the challenges of membrane protein isolation?

Purification of recombinant membrane proteins presents unique challenges due to their hydrophobic nature. For TCoV M protein, a methodological approach would involve:

  • Initial extraction: Using detergents compatible with maintaining protein structure (e.g., n-dodecyl-β-D-maltoside or CHAPS)

  • Affinity chromatography: If expressed as a fusion protein (e.g., His-tagged or GST-tagged)

  • Size exclusion chromatography: To separate protein aggregates and obtain homogeneous preparations

  • Ion exchange chromatography: For further purification based on charge properties

Specific buffer conditions including stabilizing agents such as glycerol or specific lipids may be necessary to maintain protein stability throughout the purification process. The presence of glycosylation in the native M protein suggests that expression systems capable of post-translational modifications might be preferable for functional studies, though E. coli-based systems could still be valuable for structural analyses requiring high protein yields.

How can researchers specifically detect TCoV M protein in experimental samples?

A more specific approach involves developing antibodies against unique regions of the TCoV M protein. Similar to the approach used for N protein, researchers could develop:

  • ELISA-based detection: Using purified recombinant M protein as antigen or using monoclonal antibodies against M protein

  • Western blotting: For detecting M protein in tissue samples or recombinant preparations

  • Immunohistochemistry: For localization studies in infected tissues

For molecular detection, primers targeting unique regions of the M gene sequence could be designed to improve specificity. Current data indicates that some M gene assays have failed to produce products for positive TCoV samples tested in diagnostic laboratories, suggesting ongoing evolutionary changes that may affect primer binding sites .

What analytical challenges arise when studying recombinant M protein compared to native viral protein?

Several analytical challenges emerge when working with recombinant M protein compared to its native counterpart:

ChallengeNative M ProteinRecombinant M Protein
GlycosylationN- and O-glycosylatedMay lack proper glycosylation in bacterial systems; more accurate in eukaryotic systems
Membrane associationIntegrated in viral envelopeOften expressed without proper membrane context
ConformationNatural folding in viral contextMay have altered folding affecting epitope exposure
Protein-protein interactionsInteracts with other viral proteinsIsolated protein may lack interaction partners
StabilityStabilized by viral structureMay require special conditions for stability

To address these challenges, researchers should consider using multiple expression systems, carefully designing constructs that retain critical domains, and developing validation methods to confirm that recombinant proteins retain native-like properties. Comparative analyses between recombinant proteins and virus-derived proteins can help identify potential artifacts introduced during recombinant expression.

How do recombination events affect the M gene in turkey coronavirus evolution?

While recombination events in TCoV have been primarily documented in the spike (S) gene region, these events can also affect the genomic context in which the M gene exists. Analysis of recombination events in TCoV genomes has shown that the S gene structures may be particularly mobile, willingly switching between different gammacoronavirus genomic backbones .

For example, a Polish TCoV strain (gCoV/Tk/Poland/G160/2016) emerged from a recombination between the Polish IBV strain (major parent) and a guinea fowl coronavirus (minor parent), with breaking points at nucleotide position 20,099 and ending at position 23,799 . This recombination primarily affected the S gene but demonstrates the genomic plasticity that can potentially impact M gene expression and function through altered regulatory elements or through changes in interactions with other viral proteins.

Researchers studying the M protein should be aware of these recombination events and consider phylogenetic analyses to understand the evolutionary context of their specific M gene sequences, particularly when comparing functional properties across different isolates.

What molecular techniques are most effective for studying recombination events affecting the M gene?

To study recombination events affecting the M gene and surrounding genomic regions, several molecular techniques have proven effective:

  • Whole-genome sequencing: Provides comprehensive data for recombination analysis

  • Recombination detection programs: Software packages like RDP4 that implement multiple methods (RDP, GENECONV, BootScan, MaxChi, Chimaera, SiScan, 3Seq) to identify potential recombination events

  • SimPlot analysis: Visualizes the similarity of particular genome fragments to different reference sequences

  • Phylogenetic analysis: Maximum likelihood methods with appropriate nucleotide substitution models help establish evolutionary relationships

  • TMRCA (Time to Most Recent Common Ancestor) analyses: Estimates divergence times between different viral lineages

When specifically focusing on the M gene, researchers should sequence not only the gene itself but also flanking regions to identify potential recombination breakpoints. Comparing sequences across multiple isolates from different geographical regions and host species can provide valuable insights into the evolutionary history and potential functional consequences of recombination events.

How do post-translational modifications of the M protein affect its functionality?

The TCoV M protein undergoes both N- and O-glycosylation , which likely impacts its functionality in several ways:

  • Protein folding and stability: Glycosylation can affect the folding efficiency and stability of the protein

  • Antigenicity: Glycans can mask epitopes or create new ones, affecting immune recognition

  • Protein-protein interactions: Glycosylation can modulate interactions with other viral proteins or host factors

  • Virion assembly: Changes in glycosylation patterns may affect the efficiency of viral assembly

To study these effects, researchers might employ site-directed mutagenesis to alter potential glycosylation sites, compare protein properties between glycosylated and non-glycosylated forms, or use inhibitors of specific glycosylation pathways in viral infection models. The potential N-glycosylation site identified at the N terminus of the TCoV M protein provides a starting point for such investigations.

How can recombinant M protein be used for developing diagnostic tools for TCoV?

Recombinant M protein can serve as a valuable tool for developing TCoV diagnostics:

  • ELISA development: Purified recombinant M protein can be used as coating antigen for antibody detection assays, similar to the approach used with N protein that achieved 97% sensitivity and 93% specificity

  • Production of monoclonal antibodies: Recombinant M protein can be used to immunize animals for generating specific antibodies for various immunoassays

  • Lateral flow assays: M protein-based rapid tests could be developed for field diagnostics

When developing such diagnostic tools, researchers should consider:

  • Protein conformation and epitope preservation

  • Cross-reactivity with other coronaviruses (particularly IBV)

  • Consistency of recombinant protein preparations

  • Validation with clinical samples from infected and non-infected birds

The validation approach should include testing against samples from experimentally infected turkeys at different time points post-infection, as well as field samples to establish sensitivity, specificity, and predictive values in real-world scenarios.

What is the potential of the M protein as a target for vaccine development against TCoV?

The M protein presents several advantages as a potential vaccine target against TCoV:

  • Conservation: The high sequence conservation (>99% similarity to BCV ) suggests that immune responses directed against M protein might provide broad protection against different TCoV strains

  • Immunogenicity: As a structural protein, M protein is likely to elicit strong antibody responses

  • T-cell epitopes: M protein may contain T-cell epitopes that could contribute to cell-mediated immunity

Potential vaccine approaches utilizing recombinant M protein include:

  • Subunit vaccines based on purified recombinant M protein

  • DNA vaccines encoding the M gene

  • Viral vector vaccines expressing the M protein

  • Combined approaches targeting multiple structural proteins (M, N, S)

Challenges that researchers must address include ensuring proper protein conformation in vaccine formulations, determining correlates of protection, and developing appropriate challenge models to assess vaccine efficacy. Given that TCoV primarily affects the gastrointestinal tract, mucosal immunity will be a crucial consideration in vaccine design.

How do interactions between M protein and other viral proteins contribute to coronavirus structure and function?

Advanced research into M protein interactions requires sophisticated methodological approaches:

  • Co-immunoprecipitation: To identify physical interactions between M protein and other viral or host proteins

  • Proximity ligation assays: For detecting in situ protein interactions in infected cells

  • Cryo-electron microscopy: To visualize M protein arrangement in the virion structure

  • Reverse genetics systems: To study the effects of M protein mutations on viral assembly and infectivity

Key interactions to investigate include:

  • M-S protein interactions that facilitate incorporation of spike proteins into the virion

  • M-N protein interactions essential for nucleocapsid incorporation and viral assembly

  • M-E protein interactions that shape the viral envelope

  • M protein homodimerization/oligomerization that contributes to envelope structure

These studies would provide insights not only into TCoV biology but also into fundamental mechanisms of coronavirus assembly that might be applicable across the Coronaviridae family.

What are the structural determinants of M protein that contribute to tissue tropism and host specificity?

The M protein may contribute to tissue tropism and host specificity through several mechanisms:

  • Interactions with host factors: Specific regions of the M protein may interact with host-specific cellular factors

  • Contribution to viral stability: M protein characteristics may affect viral stability in different environments (e.g., gastrointestinal tract)

  • Modulation of host immune responses: M protein variants may differentially affect innate immune sensing

  • Co-evolution with S protein: M protein adaptations may complement S protein changes during host adaptation

Methodological approaches to investigate these questions include:

  • Comparative structural analysis of M proteins from different coronavirus species

  • Chimeric virus construction to swap M proteins between coronaviruses with different host ranges

  • Systematic mutagenesis of M protein domains followed by functional assays

  • Identification of host factors that interact with M protein using techniques such as BioID or affinity purification followed by mass spectrometry

These advanced studies would contribute to understanding the molecular basis of coronavirus host specificity and potentially inform strategies for preventing cross-species transmission events.

What experimental controls are essential when working with recombinant TCoV M protein?

When designing experiments with recombinant TCoV M protein, several critical controls should be incorporated:

  • Expression controls:

    • Empty vector control to account for host cell proteins

    • Expression of an unrelated protein using the same system to control for expression system effects

    • Expression of another coronavirus M protein for comparative analyses

  • Purification controls:

    • Mock purification from non-transformed cells

    • Purification of a well-characterized protein using the same protocol

  • Functional assays:

    • Positive controls using native viral preparations where feasible

    • Negative controls with denatured protein to distinguish structure-dependent functions

    • Dose-response experiments to establish optimal protein concentrations

  • Antibody specificity controls:

    • Pre-immune serum controls

    • Absorption controls to verify specificity

    • Cross-reactivity testing with related coronavirus proteins

Proper implementation of these controls helps ensure experimental rigor and facilitates accurate interpretation of results when characterizing recombinant M protein.

How should researchers design experiments to study M protein glycosylation and its impact on protein function?

To study M protein glycosylation and its functional impact, researchers should consider this experimental approach:

  • Site-directed mutagenesis:

    • Mutate the N-glycosylation site at the N terminus of TCoV M protein

    • Create single and multiple mutants if additional glycosylation sites are identified

    • Design constructs for expression in both prokaryotic (non-glycosylating) and eukaryotic (glycosylating) systems

  • Expression systems comparison:

    • Express wild-type and mutant proteins in E. coli (no glycosylation)

    • Express in insect cells (partial glycosylation)

    • Express in mammalian cells (full glycosylation)

  • Glycosylation analysis:

    • Enzymatic deglycosylation with PNGase F (for N-linked) and O-glycosidases

    • Mass spectrometry to characterize glycan structures

    • Lectin binding assays to profile glycan composition

  • Functional assessment:

    • Protein folding and stability measurements

    • Membrane association assays

    • Protein-protein interaction studies with other viral components

    • Immunogenicity testing of differently glycosylated forms

This systematic approach would provide comprehensive insights into how glycosylation affects the structural and functional properties of the TCoV M protein.

How can researchers address discrepancies between in vitro studies of recombinant M protein and in vivo observations?

Discrepancies between in vitro and in vivo findings are common challenges in coronavirus research. To address these discrepancies, researchers should:

  • Evaluate protein conformation:

    • Assess if recombinant protein maintains native-like structure

    • Consider membrane environments for functional studies

    • Use multiple complementary techniques to characterize protein properties

  • Consider cellular context:

    • Develop cell-based assays that mimic physiological conditions

    • Use primary turkey intestinal cells when possible rather than immortalized cell lines

    • Establish organoid models of turkey intestinal tissue

  • Bridge the gap with ex vivo systems:

    • Utilize intestinal loop models or tissue explants

    • Implement isolated perfused intestine preparations

    • Develop infection models in embryonated turkey eggs

  • Validate with in vivo samples:

    • Compare recombinant protein characteristics with proteins isolated from infected tissues

    • Develop improved protein extraction methods for membrane proteins from tissues

    • Use proximity labeling in vivo to capture transient interactions

By systematically addressing these factors, researchers can better understand the sources of discrepancies and develop more physiologically relevant experimental systems.

What strategies can overcome common challenges in recombinant membrane protein production?

Recombinant membrane protein production faces several challenges that can be addressed with specific strategies:

ChallengeStrategic Solution
Low expression levelsTest multiple expression systems; optimize codon usage; use strong inducible promoters; try fusion partners that enhance solubility
Protein misfoldingExpress at lower temperatures; use specialized E. coli strains (e.g., C41/C43); include molecular chaperones; test membrane-mimetic systems
AggregationInclude stabilizing agents (glycerol, specific detergents); optimize buffer conditions; use nanodiscs or amphipols for membrane proteins
Toxicity to host cellsUse tight expression control; develop leak-free expression systems; express toxic domains separately
Difficult purificationOptimize detergent selection; use orthogonal purification tags; implement multi-step purification strategies
Post-translational modification differencesUse eukaryotic expression systems; engineer glycosylation sites; evaluate impact of modifications systematically

When applying these strategies to TCoV M protein production, researchers should consider starting with constructs that exclude the most hydrophobic transmembrane domains or express these domains separately for subsequent reconstitution experiments.

What emerging technologies might enhance our understanding of TCoV M protein structure and function?

Several emerging technologies hold promise for advancing TCoV M protein research:

  • Cryo-electron microscopy (Cryo-EM):

    • Single-particle analysis for high-resolution structural determination

    • Tomography for visualizing M protein arrangement within virions

    • In situ structural studies within infected cells

  • AlphaFold and other AI-based structure prediction:

    • Accurate prediction of M protein structure and dynamics

    • Modeling protein-protein interactions

    • Virtual screening for molecules targeting M protein

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Characterization of protein-lipid interactions

    • Determination of stoichiometry in protein assemblies

  • Advanced genetic systems:

    • CRISPR-based genome editing of turkey cell lines

    • Development of reverse genetics systems for TCoV

    • Synthetic genomics approaches to study M protein variants

  • Single-cell technologies:

    • Single-cell transcriptomics of infected tissues

    • Spatial transcriptomics to map infection dynamics

    • Proteomics at cellular resolution

These technologies would provide unprecedented insights into M protein biology and potentially reveal new strategies for diagnostic development and therapeutic intervention.

How might comparative studies between TCoV and other coronaviruses inform our understanding of M protein evolution and function?

Comparative studies between TCoV and other coronaviruses represent a powerful approach to understanding M protein evolution and function:

  • Evolutionary analysis:

    • Molecular clock analyses to determine divergence times between coronavirus M proteins

    • Selection pressure analysis to identify conserved functional domains

    • Ancestral sequence reconstruction to understand evolutionary trajectories

  • Structure-function comparisons:

    • Mapping functional differences to structural variations

    • Identifying conserved interaction interfaces

    • Characterizing species-specific adaptations

  • Host adaptation studies:

    • Comparing M proteins from coronaviruses with different host ranges

    • Identifying molecular determinants of host specificity

    • Characterizing adaptation signatures in M protein sequences

  • Cross-species transmission potential:

    • Evaluating the capacity of M proteins to function in heterologous systems

    • Identifying barriers to cross-species transmission

    • Assessing zoonotic potential through comparative analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.