Recombinant Turkey rhinotracheitis virus Major surface glycoprotein G (G)

Shipped with Ice Packs
In Stock

Description

Structure and Composition

The fusion (F) glycoprotein of turkey rhinotracheitis virus (TRTV) has a deduced amino acid sequence that shows greater identity with the fusion protein of human respiratory syncytial virus, a pneumovirus, than with those of paramyxoviruses and morbilliviruses . The F protein consists of 538 amino acids, with the F2 and F1 subunits containing 102 (including the F2-F1 connecting peptide RRRR) and 436 residues, respectively; each subunit has one potential N-linked glycosylation site . The protein exhibits 38% to 39% amino acid identity with the F protein of respiratory syncytial virus (Pneumovirus genus) but only about half that with members of the other two genera (Paramyxovirus and Morbillivirus) in the Paramyxoviridae family .

Glycoprotein Gn, a type I transmembrane protein, combines with glycoprotein Gc to form non-covalently linked heterodimers on the virion's lipid bilayer envelope, facilitating virus attachment, cell uptake, and Gc-mediated cell fusion . The Gn protein comprises an N-terminal ectodomain, a C-terminal transmembrane domain, and a cytoplasmic tail. The ectodomain, a primary target for neutralizing antibodies, includes an N-terminal helical domain, a β-ribbon, and a small globular domain .

Production via Recombinant Technology

Recombinant viruses, such as Newcastle Disease Virus (NDV), can be engineered to express the G protein of aMPV. For example, a LaSota strain-based recombinant NDV virus expressing the G protein of aMPV-A or -B has been developed as a bivalent vaccine candidate . The insertion of transcription cassettes containing NDV LaSota intergenic regions and the G gene ORF of aMPV-A or -B increases the length of the recombinant clones . The fidelity of rescued viruses is confirmed by sequence analysis from RT-PCR products of the viral genome .

Role in Viral Pathogenesis

The G protein's role in viral pathogenesis is complex. While it facilitates initial attachment to host cells, viruses with G protein deletions can still replicate, albeit with reduced virulence in vivo . Research indicates that the G protein may be essential for efficient virus growth in turkeys, as viruses with G gene deletions are attenuated in turkeys .

Impact on Immune Response

The G protein influences the host's immune response. Studies have shown that recombinant viruses lacking the G protein induce higher levels of chemokines and type I interferon (IFN) in airway epithelial cells compared to wild-type viruses . The G protein can inhibit the host antiviral response by blocking the production of inducible chemokines and IFN-α/β . It has been demonstrated that the G protein interacts with RIG-I, a cytoplasmic viral sensor, to suppress antiviral signaling .

Immune MarkerrhMPV-ΔGrhMPV-WT
IL-6HigherLower
IL-8HigherLower
IP-10HigherLower
MCP-1HigherLower
MIP-1αHigherLower
RANTESHigherLower

Vaccine Development and Efficacy

Recombinant viruses expressing the G protein have been evaluated as vaccine candidates. Immunization with recombinant NDV viruses expressing the G protein of aMPV-A or -B induces high NDV-specific HI antibody titers and provides protection against NDV challenge in turkeys .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
G; Major surface glycoprotein G; Attachment glycoprotein G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Turkey rhinotracheitis virus (TRTV)
Target Names
G
Target Protein Sequence
MGSKLYMVQGTSAYQTAVGFWLDIGRRYILAIVLSAFGLTCTVTIALTVSVIVEQSVLEE CRNYNGGDRDWWSTTQEQPTTAPSATPAGNYGGLQTARTRKSESCLHVQISYGDMYSRSD TVLGGFDCMGLLVLCKSGPICQRDNQVDPTALCHCRVDLSSVDCCKVNKISTNSSTTSEP QKTNPAWPSQDNTDSDPNPQGITTSTATLLSTSLGLMLTSKTGTHKSGPPQALPGSNTNG KTTTDREPGPTNQPNSTTNGQHNKHTQRMTPPPSHDNTRTILQHTTPWEKTFSTYKPTHS PTNESDQSLPTTQNSINCEHFDPQGKEKICYRVGSYNSNITKQCRIDVPLCSTYSTVCMK TYYTEPFNCWRRIWRCLCDDGVGLVEWCCTS
Uniprot No.

Target Background

Function
This protein is likely the virus attachment protein.
Subcellular Location
Host cell surface. Virion membrane. Note=Expressed on the surface of the infected cells and incorporated in the membrane of the virions.

Q&A

How are recombinant viruses expressing aMPV glycoprotein G constructed?

Construction of recombinant Newcastle Disease Virus (NDV) expressing aMPV glycoprotein G involves several sophisticated molecular techniques. Researchers typically employ reverse genetics technology to generate these recombinant viruses. The process begins with the amplification of the G gene open reading frame (ORF) from aMPV genomic RNA through RT-PCR. This G gene ORF is then cloned into a full-length cDNA clone of the NDV LaSota vaccine strain, specifically inserting it into the intergenic region between the F and HN genes .

The insertion is typically performed using a two-step process with specialized cloning kits (such as the In-Fusion® PCR cloning kit). When constructing these recombinant viruses, researchers must ensure that the total genome length adheres to the "Rule of Six" for paramyxoviruses - meaning the genome length must be divisible by six for efficient replication. For example, the insertion of aMPV-A G and aMPV-B G transcription cassettes increased the recombinant clone lengths by 1338 and 1410 nucleotides respectively, resulting in total lengths of 16,524 and 16,596 nucleotides .

What methods are used to confirm the expression of aMPV G protein in recombinant viruses?

Confirmation of aMPV G protein expression in recombinant viruses typically employs immunofluorescence assay (IFA). Researchers infect susceptible cell lines (such as DF-1 cells) with the recombinant virus, then examine protein expression using specific antibodies. In published studies, chicken anti-aMPV-B serum combined with FITC-labeled goat anti-chicken IgG has been used to detect the G protein .

To precisely localize the expressed G protein in relation to the recombinant virus-infected cells, dual staining techniques can be employed. This involves using mouse anti-NDV HN monoclonal antibody (Mab) and Alexa Fluor® 568 conjugated goat anti-mouse IgG to visualize NDV proteins, while simultaneously detecting the aMPV G protein with the antibodies mentioned above. Under fluorescence microscopy, successful expression is confirmed when both green (G protein) and red (NDV proteins) fluorescence signals co-localize in the same infected cells, corresponding to visible cytopathic effects. This co-localization confirms that the aMPV G protein is indeed expressed alongside NDV proteins in the recombinant virus-infected cells .

How does the insertion of aMPV G gene affect the biological characteristics of recombinant NDV vectors?

The insertion of the aMPV G gene into the NDV LaSota backbone appears to have minimal impact on the biological characteristics of the vector, though some subtle changes do occur. Comprehensive biological characterization involves multiple parameters assessment:

Pathogenicity indicators show that recombinant viruses (rLS/aMPV-A G and rLS/aMPV-B G) are slightly attenuated compared to the parental LaSota strain, with lower intracerebral pathogenicity index (ICPI) values of 0.0 versus the parental strain's higher index . This attenuation is beneficial from a vaccine safety perspective.

Despite this slight attenuation, the growth dynamics remain largely unaffected. Virus titers measured by EID₅₀ (egg infective dose), TCID₅₀ (tissue culture infective dose), and HA (hemagglutination) assays in both embryonated eggs and DF-1 cells show comparable values between the recombinant viruses and the parental LaSota strain . The cytopathic effects induced by recombinant virus infection are indistinguishable from those seen with the parental virus.

The recombinant viruses also demonstrate remarkable stability, showing no apparent changes in mean death time (MDT) and virus titers even after 10 passages in SPF chicken embryos . This stability is crucial for vaccine development as it ensures consistent vaccine performance over multiple passages.

What is the comparative immunogenicity of glycoprotein G from different aMPV subtypes when expressed in recombinant vectors?

Research data indicates that glycoprotein G from different aMPV subtypes (specifically A and B) demonstrates similar immunogenic properties when expressed in recombinant NDV vectors, though both show limitations as standalone antigens. Comparative immunogenicity studies have revealed several key findings:

Neither rLS/aMPV-A G nor rLS/aMPV-B G recombinant viruses induce detectable aMPV subtype-specific antibody responses when measured by ELISA, suggesting that the G protein alone is a weak immunogen regardless of subtype . This weak immunogenicity is consistent across subtypes and represents a significant limitation for single-protein vaccine strategies.

Despite the absence of detectable antibodies, both recombinant constructs confer partial protection against homologous aMPV challenge, with comparable levels of protection between subtypes. The protective effect is evident in the reduced severity of clinical signs and decreased viral shedding at 9 days post-challenge, with 50% of rLS/aMPV-A G vaccinated birds and 70% of rLS/aMPV-B G vaccinated birds showing no viral RNA shedding .

Vaccinated turkeys in both groups (A and B) show similar patterns of clinical sign reduction, with vaccinated birds exhibiting significantly milder symptoms than control groups. The clinical signs in vaccinated birds typically resolve by 11 days post-challenge, while control birds may continue showing symptoms for up to 14 days post-challenge .

Why is the G protein considered a weak antigen in aMPV vaccine development?

The G protein of aMPV is considered a weak antigen based on several experimental observations from immunization and challenge studies. When expressed alone in recombinant vectors, the G protein fails to induce detectable aMPV-specific antibody responses in vaccinated turkeys, despite using sensitive ELISA techniques . This lack of measurable humoral response directly indicates its weak immunogenicity.

Furthermore, turkeys vaccinated with recombinant viruses expressing the G protein receive only partial protection against homologous aMPV challenge. While vaccinated birds show reduced clinical symptoms and viral shedding compared to unvaccinated controls, they still develop some disease manifestations following challenge . The incomplete protection contrasts sharply with the complete protection these same recombinant viruses provide against NDV challenge, further highlighting the G protein's limitations as an immunogen.

Research has demonstrated that G deletion or truncation mutants of aMPV remain viable in cell cultures, though they appear attenuated in SPF turkeys and induce weaker immune responses than wild-type virus . This suggests that while G protein contributes to immunogenicity in the natural host, it is not sufficient alone to stimulate robust protective immunity.

These findings collectively support the hypothesis that effective aMPV vaccines may require co-expression of multiple viral proteins. Researchers suggest that combining G with other major structural proteins such as F (fusion) and/or M (matrix) proteins may be necessary to induce enhanced protective immunity against aMPV infection .

What methods are used to evaluate the protective efficacy of recombinant G protein vaccines?

Evaluation of recombinant G protein vaccines involves comprehensive methodologies that assess both immunological responses and protection against challenge. The standard protocol includes:

Immunization protocol: Typically involves administration of recombinant viruses (e.g., rLS/aMPV-A G or rLS/aMPV-B G) to susceptible birds such as turkeys, with appropriate control groups receiving PBS or other control substances. The route of administration is important, with intranasal/intraocular (IN/IO) routes being common for respiratory pathogens .

Antibody response assessment: NDV-specific antibody responses are measured using hemagglutination inhibition (HI) tests, while aMPV-specific antibodies are assessed using enzyme-linked immunosorbent assay (ELISA) with purified aMPV antigens . The sensitivity of these assays is critical for detecting potentially weak immune responses.

Challenge studies: Challenge experiments typically involve exposure to virulent strains of both NDV and aMPV. For NDV, direct challenge with lethal doses is standard. For aMPV, both direct challenge and transmission challenge models are used, with the latter mimicking natural infection routes more accurately . The transmission challenge model allows assessment of vaccine efficacy under conditions that more closely resemble field situations.

Clinical evaluation: Following challenge, birds are monitored daily for clinical signs, which are scored using standardized systems. For aMPV, the scoring system typically includes: Score 1 (nasal exudates when squeezed), Score 2 (nasal discharge), and Score 3 (frothy eyes) . Mean clinical scores are calculated for each group and plotted over time to visualize disease progression and recovery.

Viral shedding assessment: RT-PCR detection of viral RNA from tracheal samples at various days post-challenge (typically 5, 7, and 9 DPC) provides objective evidence of protection. The percentage of birds negative for viral shedding serves as a key endpoint for vaccine efficacy . This data is typically presented in tabular format as shown below:

Group5 DPC7 DPC9 DPC
Control0% (0/10)0% (0/10)0% (0/10)
rLS/aMPV-A G10% (1/10)20% (2/10)50% (5/10)
rLS/aMPV-B G10% (1/10)30% (3/10)70% (7/10)

Table: Percentage of birds negative for viral RNA shedding following homologous aMPV challenge (adapted from data in source)

How are recombinant viruses characterized for safety and stability?

Comprehensive characterization of recombinant viruses for safety and stability involves multiple standardized assays that assess key parameters relevant to vaccine development. These methods include:

Pathogenicity testing: Standard tests include the mean death time (MDT) in embryonated eggs and the intracerebral pathogenicity index (ICPI) in day-old chickens. The MDT measures the average time (in hours) required for the minimum lethal dose of virus to kill all chicken embryos, while the ICPI quantifies neurological pathogenicity on a scale of 0 (avirulent) to 2 (highly virulent) . Lower values in both tests indicate greater attenuation and safety.

Growth characteristics: Growth dynamics are assessed through multi-step growth curves in susceptible cell lines (such as DF-1), with virus titers determined at different time points post-infection. Comparable growth patterns between recombinant and parental viruses indicate that the insertion of foreign genes does not significantly impair virus replication .

Genetic stability: Stability is evaluated through serial passages (typically 10 or more) in embryonated eggs or cell cultures, followed by genome sequencing to confirm retention of the inserted foreign gene and absence of unwanted mutations. Consistent biological characteristics (MDT, virus titers) across passages provide additional evidence of stability .

In vitro replication competence: Virus titers are measured using multiple methods, including:

  • EID₅₀ (50% egg infective dose) in embryonated eggs

  • TCID₅₀ (50% tissue culture infective dose) in cell cultures

  • HA (hemagglutination) titers in standard microplate assays

Results from these assessments are typically presented in tabular format, as illustrated below:

VirusMDT (hours)ICPIHA titer (log₂)EID₅₀ (log₁₀)TCID₅₀ (log₁₀)
LaSota (parental)1120.489.58.2
rLS/aMPV-A G1200.089.27.9
rLS/aMPV-B G1180.079.38.0

Table: Biological characteristics of parental and recombinant viruses (adapted from data in source)

What molecular techniques are essential for constructing and verifying recombinant viruses expressing aMPV G?

Construction and verification of recombinant viruses expressing aMPV G protein requires a sophisticated molecular toolkit. The essential techniques include:

Reverse genetics system: The foundation of creating recombinant paramyxoviruses is a reverse genetics system that allows rescue of infectious virus from cloned cDNA. This typically involves a full-length cDNA clone of the virus genome (e.g., pFLC-LaSota for NDV) and supporting plasmids expressing viral polymerase proteins . The system enables precise genetic modifications and insertions at defined genomic positions.

PCR amplification and cloning: The aMPV G gene open reading frame must be precisely amplified from viral genomic RNA using RT-PCR with specific primers that incorporate appropriate regulatory elements and restriction sites. Modern cloning technologies such as In-Fusion® PCR cloning facilitate seamless insertion of the amplified fragment into the vector backbone .

Transcriptional signal insertion: Proper expression of the foreign gene requires insertion of paramyxovirus-specific transcriptional signals, including gene start (GS) and gene end (GE) sequences, flanking the inserted aMPV G gene . These signals ensure appropriate transcription of the inserted gene as a separate mRNA.

Transfection and virus rescue: Co-transfection of the full-length cDNA clone along with supporting plasmids into suitable cells (typically HEp-2) followed by amplification in embryonated eggs leads to rescue of recombinant viruses . This complex process requires optimization of transfection conditions and selection of appropriate host systems.

Verification methods:

  • RT-PCR and sequencing to confirm the insertion and fidelity of the foreign gene

  • Immunofluorescence assays using specific antibodies to verify protein expression

  • Western blotting to confirm correct protein size and expression levels

  • Growth curve analysis to ensure the recombinant virus maintains replication competence

These molecular approaches must be conducted with meticulous attention to detail, particularly ensuring that the "Rule of Six" is maintained - the total genome length must be divisible by six for efficient replication of paramyxoviruses .

How effective are recombinant NDV vaccines expressing aMPV G protein in providing dual protection?

Recombinant NDV vaccines expressing aMPV G protein demonstrate differential effectiveness against the two target pathogens, providing complete protection against NDV but only partial protection against aMPV. This asymmetric protection profile has been well-documented in controlled challenge studies.

Against NDV challenge, these recombinant vaccines perform exceptionally well. Turkeys immunized with either rLS/aMPV-A G or rLS/aMPV-B G develop robust NDV-specific hemagglutination inhibition (HI) antibody titers, comparable to those induced by the parental LaSota strain . When challenged with a lethal dose of velogenic NDV (CA02 strain), vaccinated birds show 100% survival without any clinical signs of disease, while unvaccinated controls exhibit typical clinical manifestations (conjunctivitis, severe depression) and 100% mortality by 5 days post-challenge . This complete protection demonstrates that the insertion of the foreign aMPV G gene does not compromise the efficacy of the NDV vector as a vaccine against NDV itself.

In contrast, protection against aMPV is less robust. Following challenge with homologous pathogenic aMPV-A or -B, vaccinated turkeys show significantly reduced clinical signs compared to unvaccinated controls (p<0.01), but not complete absence of disease . The mean clinical scores over time reveal that vaccinated birds primarily develop milder symptoms (nasal exudates when squeezed or nasal discharge) that resolve more quickly (by 11 days post-challenge) compared to control birds, which exhibit more severe symptoms (including frothy eyes) that persist longer (at least 14 days post-challenge) .

Viral shedding data further supports this partial protection profile. By 9 days post-challenge, 50% of rLS/aMPV-A G vaccinated birds and 70% of rLS/aMPV-B G vaccinated birds were negative for viral RNA in tracheal samples, compared to 0% in control groups . This reduction in viral shedding, while significant, falls short of the complete clearance that would indicate sterilizing immunity.

What are the limitations of using G protein alone in developing effective aMPV vaccines?

The limitations of using G protein alone for aMPV vaccine development have been revealed through multiple experimental approaches, highlighting several key constraints:

Poor antibody induction: Perhaps the most significant limitation is the failure of G protein, when expressed alone in recombinant vectors, to induce detectable aMPV-specific antibody responses in vaccinated animals. Despite using sensitive ELISA techniques, researchers have been unable to detect G protein-specific antibodies in vaccinated turkey sera . This poor humoral response severely limits the protective potential of G protein-only vaccines.

Incomplete protection: Vaccination with recombinant viruses expressing only the G protein provides just partial protection against aMPV challenge. While clinical signs are reduced in severity and duration, vaccinated birds still develop disease manifestations following challenge, indicating that the immune response generated is insufficient for complete protection .

Limited impact on viral shedding: Even after vaccination, a substantial proportion of birds (30-50%) continue to shed challenge virus at 9 days post-challenge . This continued shedding has important epidemiological implications, as vaccinated birds could potentially serve as carriers, maintaining virus circulation within flocks.

Molecular evidence: Studies with G deletion or truncation mutants of aMPV have shown that these viruses remain viable in cell cultures, although they are attenuated in turkeys . This suggests that while G protein contributes to virulence and immunogenicity, it is not essential for the virus life cycle and may not represent the most critical target for protective immunity.

These limitations collectively indicate that effective aMPV vaccines may require a multi-antigen approach, incorporating additional viral proteins such as the fusion (F) protein, which is often a major target for neutralizing antibodies in respiratory viruses .

How can protection against aMPV be improved in future recombinant vaccine designs?

Improving protection against aMPV in future recombinant vaccine designs requires strategic approaches based on current research findings. Several promising strategies emerge from the literature:

Multi-antigen expression: The most compelling approach involves co-expression of multiple aMPV structural proteins, particularly the fusion (F) protein along with G protein. Research suggests that the F protein may be more immunogenic and could induce stronger neutralizing antibody responses . Recombinant vectors expressing both F and G proteins could potentially induce complementary immune responses targeting different stages of viral infection.

Optimized expression systems: Enhancing the expression level and proper folding of the G protein may improve its immunogenicity. This could involve codon optimization, incorporation of molecular adjuvants, or modification of signal sequences to increase cell surface expression . Higher expression levels might overcome the weak antigenicity of the G protein.

Prime-boost strategies: Heterologous prime-boost vaccination regimens, using different vaccine platforms expressing the same aMPV antigens, could potentially enhance both humoral and cell-mediated immune responses. For example, priming with a recombinant viral vector followed by boosting with a protein subunit vaccine might generate broader and more durable immunity .

Mucosal immunity enhancement: Since aMPV is a respiratory pathogen, strengthening mucosal immunity at sites of natural infection is crucial. This could involve optimizing vaccine delivery routes (e.g., aerosol or intranasal administration) or incorporating mucosa-targeting adjuvants to enhance local immune responses in the respiratory tract .

Targeting conserved epitopes: Developing vaccines that target highly conserved epitopes across different aMPV subtypes could potentially provide broader cross-protection. Structural biology approaches to identify such conserved regions, particularly in the F protein, could guide next-generation vaccine design .

Implementation of these strategies requires comprehensive testing in appropriate animal models, with careful evaluation of both immunogenicity markers and protection against challenge. The goal should be to develop vaccines that not only prevent clinical disease but also block virus shedding to interrupt transmission cycles in poultry populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.