Recombinant Turnip yellows virus Protein P1 (ORF1), partial

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ORF1; Protein P1; 66.2 kDa protein; Genome-linked protein precursor; Protein ORF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
401-607
Protein Length
partial
Species
Turnip yellows virus (isolate FL-1) (TuYV) (BWYV-FL1)
Target Names
ORF1
Target Protein Sequence
TTAPQGRVFAQEDIAEIEGLYAQVMKRVQQAEDFKPKTGKYWGDMEDDEDIFFESKEDLS GNGVRGTVRGTNGEGSSTPKTSNVDGKEMMEKIISSLVGKINLENIERKVIEEISAKAMK TPKSRRRRAPKKQPESSKDTSPRSTTGKYQPPHVRSPASVTAANCPNTTTPSKKKNLAGG RPSSGTIPRWVRKQAASAGPSSAPKQN
Uniprot No.

Target Background

Function

This protein is a precursor likely involved in the release of the VPg molecule at the initiation of RNA synthesis. It plays a crucial role in viral replication.

Database Links

KEGG: vg:940483

Protein Families
Peptidase S39B family
Subcellular Location
[Protein P1]: Membrane; Multi-pass membrane protein.

Q&A

What is the Turnip yellows virus P1 protein and what is its role in viral infection?

The P1 protein of Turnip yellows virus (TuYV) is a multifunctional viral protein encoded by the ORF1 region of the viral genome. While detailed data on TuYV P1 is limited in the provided context, research on related viruses in the family Potyviridae indicates that P1 proteins are typically involved in host adaptation and robust viral infection. P1 proteins often function as accessory factors that enhance genome amplification by suppressing host antiviral defenses. These proteins commonly possess protease activity in their C-terminal domains that catalyzes their separation from viral polyproteins, which is essential for proper viral function . Additionally, P1 is known to interact with host factors, such as the NODULIN 19 (NOD19) protein in the case of Turnip mosaic virus, facilitating robust infection through mechanisms that remain partially elusive .

How does the structure of P1 protein compare to other viral proteins in the Polerovirus genus?

P1 proteins are among the most divergent viral proteins within plant virus families. Particularly in the Potyviridae family, the N-terminal region of P1 is highly variable in both size and sequence, which likely contributes to its role in host adaptation and pathogenicity determination . The P1 protein typically contains a serine protease domain at its C-terminal end, which is more conserved than its N-terminal region. The protease activity is often regulated by the N-terminal variable part with assistance from host factors . In contrast to P1, other viral proteins like P0 in poleroviruses have more defined interaction motifs, such as the F-box-like motif seen in Brassica yellows virus P0 that interacts with SKP1 to enhance protein stability against host degradation pathways .

What are the key differences between P1 and P0 proteins in virus-host interactions?

Based on the available research, P1 and P0 proteins employ distinct mechanisms in virus-host interactions:

  • P1 Protein: Functions primarily as an accessory factor for robust genome amplification and host adaptation. In TuMV, P1 interacts with host factors like NOD19, a membrane-associated protein expressed in plant aerial parts, to facilitate viral infection . P1 also possesses nucleic acid binding capabilities and localizes to both cytoplasm and nucleus, suggesting multiple functional roles .

  • P0 Protein: Acts as a silencing suppressor by targeting ARGONAUTE1 (AGO1), a key component of the RNA silencing machinery. In Brassica yellows virus, P0 contains an F-box-like motif that interacts with SKP1, which enhances P0 stability against degradation by proteasome and autophagy pathways . This interaction is not directly required for silencing suppression but facilitates P0 stability to ensure efficient suppression activity .

What are the optimal conditions for recombinant expression of Turnip yellows virus P1 protein?

For recombinant expression of viral proteins like TuYV P1, the optimal conditions based on similar viral protein expressions include:

  • Expression System: E. coli is commonly used for recombinant viral protein expression, as demonstrated with the Turnip yellows virus Protein P1-P2 (Orf1/Orf2) .

  • Tags: N-terminal His-tags can be employed for purification purposes, as seen with recombinant TuYV P1-P2 protein .

  • Protein Form: The recombinant protein is typically produced as a lyophilized powder after purification .

  • Reconstitution: For optimal activity, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with addition of 5-50% glycerol (final concentration) for long-term storage .

  • Storage Conditions: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles that may compromise protein integrity .

What methods are most effective for studying P1 protein interactions with host factors?

Based on research approaches used for similar viral proteins, several methods have proven effective for studying P1-host interactions:

  • Yeast Two-Hybrid (Y2H) Screening: This technique has been successfully employed to identify potential P1-interacting host proteins. For example, Y2H screening using TuMV P1 as bait against an Arabidopsis thaliana cDNA library identified eight potential interacting proteins, including NOD19, VOZ2, TCP21, and others .

  • Bimolecular Fluorescence Complementation (BiFC): This method provides in vivo validation of protein-protein interactions in plant cells. BiFC was used to confirm the interaction between TuMV P1 and NOD19 in plant cells .

  • Genetic Analyses: Creating null mutants or knockdown lines of host interaction partners (like NOD19) and assessing viral infectivity can demonstrate the biological significance of the identified interactions .

  • Subcellular Localization Studies: Determining where both the viral protein and host factors localize can provide insights into the functional relevance of their interactions .

How do mutations in the N-terminal variable region of P1 affect host range and pathogenicity?

The N-terminal region of P1 proteins is highly variable in both size and sequence among different viral isolates. Research has shown that alterations in this region can significantly impact host range and pathogenicity profiles . The mechanism appears to involve several factors:

  • Regulation of Protease Activity: The N-terminal variable part tightly regulates the serine protease activity of the C-terminal domain, with this regulation requiring assistance from unknown host factors .

  • Host Adaptation: Changes in the N-terminal sequence of potyviruses consistently result in alterations of their host range and/or pathogenicity, suggesting this region may be involved in specific host factor recognition or evasion of host defenses .

  • Compatibility with Host Factors: The variable region likely determines compatibility with different host proteins, which may explain why certain viral strains can infect specific host plants but not others.

Experimental approaches to study these effects typically involve creating chimeric viruses with N-terminal regions from different viral isolates and assessing their infectivity and replication efficiency in various host plants.

What is the significance of P1's nucleic acid binding properties in viral replication?

P1 has been identified as a nucleic acid binding protein that localizes to both the cytoplasm and nucleus . This dual localization and nucleic acid binding capacity suggest multiple potential roles in viral replication:

  • Genome Amplification: Although not strictly required for potyviral genome amplification, P1 functions as an accessory factor that enhances this process, possibly by suppressing host antiviral defenses .

  • Transcriptional Regulation: Nuclear localization suggests P1 may influence host gene expression, potentially suppressing defense-related genes or enhancing expression of genes beneficial for viral replication.

  • RNA Stabilization: The protein may protect viral RNA from degradation by host defense mechanisms through direct binding.

  • Modulation of RNA Silencing: P1's separation from HcPro (in potyviruses) is essential for activating the RNA silencing suppression activity of HcPro, indicating an indirect role in countering host RNA silencing defenses .

Research methodologies to investigate these properties typically include electrophoretic mobility shift assays, RNA immunoprecipitation followed by sequencing, and localization studies using fluorescently tagged proteins.

How does the interaction between P1 and NOD19 contribute to viral infection success?

The interaction between viral P1 protein and the plant NODULIN 19 (NOD19) protein represents a critical molecular interface for successful viral infection. Research using the turnip mosaic virus (TuMV) system provides insights into this mechanism:

  • Facilitation of Viral Proliferation: Viral infectivity assays demonstrated that TuMV infection was significantly attenuated in Arabidopsis NOD19 null mutants and NOD19-knockdown soybean seedlings, indicating that NOD19 is required for robust viral infection .

  • Host Factor Properties: NOD19 is a membrane-associated protein expressed primarily in plant aerial parts. This localization may provide strategic advantages for the virus during infection, possibly by facilitating viral movement or replication complex formation .

  • Stress Response Connection: NOD19 is stress-upregulated, suggesting that its interaction with P1 may allow the virus to exploit plant stress response pathways during infection .

Methodologically, this relationship can be studied through a combination of protein-protein interaction assays (Y2H, BiFC), genetic manipulation of host factors (knockout/knockdown lines), and viral infectivity assays measuring parameters such as viral accumulation, symptom development, and systemic spread.

What role does protein stability play in P1 function during infection?

While specific information about TuYV P1 stability is not directly provided in the search results, insights can be drawn from research on related viral proteins such as P0:

  • Protection from Host Degradation Pathways: Similar to P0, which interacts with SKP1 to protect against degradation by proteasome and autophagy pathways , P1 likely needs to maintain stability in the host environment to effectively perform its functions.

  • Balance Between Accumulation and Processing: In potyviruses, P1 must maintain sufficient stability to perform its accessory functions while also undergoing self-cleavage from the polyprotein to activate other viral proteins like HcPro .

  • Host-Specific Stability Factors: The requirement for specific host factors to regulate P1 function suggests that protein stability may be a host-dependent factor contributing to host range determination.

Research approaches to investigate protein stability include pulse-chase experiments, proteasome inhibitor treatments, and comparison of protein accumulation in different host backgrounds.

What are the main challenges in purifying active recombinant P1 protein and how can they be addressed?

Purifying active viral proteins presents several challenges that researchers should anticipate:

  • Protein Solubility: Viral proteins often form inclusion bodies in bacterial expression systems. To address this:

    • Optimize expression conditions (temperature, IPTG concentration)

    • Use solubility-enhancing tags (MBP, SUMO)

    • Consider alternative expression systems (insect cells, plant-based systems)

  • Maintaining Protease Activity: For P1 proteins with protease domains, maintaining the proper folding required for activity is critical:

    • Include appropriate cofactors during purification

    • Ensure optimal buffer conditions (pH, salt concentration)

    • Consider expressing only the protease domain if full-length protein is problematic

  • Protein Stability During Storage: As noted for TuYV P1-P2 protein, stability during storage requires careful handling:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Add 5-50% glycerol for long-term storage

    • For working stocks, store aliquots at 4°C for no more than one week

  • Reconstitution Protocol: Follow specific reconstitution procedures for optimal activity:

    • Briefly centrifuge vials prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Consider buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been used successfully for TuYV P1-P2)

How can researchers effectively distinguish between direct and indirect effects of P1 on host defense suppression?

Distinguishing direct from indirect effects requires systematic experimental approaches:

This methodological framework allows researchers to systematically dissect the complex interactions between viral proteins and host defense systems, leading to more accurate characterization of P1 function during infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.