Recombinant TVP38/TMEM64 family membrane protein Mb0641c (Mb0641c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
BQ2027_MB0641C; TVP38/TMEM64 family membrane protein Mb0641c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0641C
Target Protein Sequence
MSTHNDSAPTSRRRHIVRLVVFAGFLVGMFYLVAATDVIDVAAVRGAVSATGPAAPLTYV VVSAVLGALFVPGPILAASSGLLFGPLVGVFVTLGATVGTAVVASLVGRRAGRASARALL GGERADRTDALIERCGLWAVVGQRFVPGISDAFASYAFGTFGVPLWQMAVGAFIGSAPRA FAYTALGAAIGDRSPLLASCAIAVWCVTAIIGAFAARHGYRQWRAHARGDGADGGVEDPD REVGAR
Uniprot No.

Target Background

Protein Families
TVP38/TMEM64 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for producing recombinant Mb0641c?

Multiple expression systems have been validated for the production of recombinant Mb0641c:

Expression SystemCharacteristicsApplications
E. coliHigh yield, cost-effective, suitable for structural studiesFunctional studies requiring non-glycosylated protein
YeastPost-translational modifications, proper foldingStudies requiring eukaryotic modifications
BaculovirusComplex protein folding, higher eukaryotic modificationsStructural biology, protein-protein interaction studies
Mammalian CellNative-like post-translational modificationsFunctional studies requiring native conformation

The selection of an expression system depends on the research objectives. E. coli systems typically yield higher amounts of protein but may lack proper folding for complex membrane proteins, while mammalian systems provide more native-like modifications but with lower yields .

What purification methods are recommended for recombinant Mb0641c?

The recommended purification workflow for recombinant Mb0641c involves:

  • Initial clarification: Centrifugation of cell lysate to remove cellular debris

  • Affinity chromatography: Utilizing the His-tag for IMAC (Immobilized Metal Affinity Chromatography)

  • Size exclusion chromatography: To achieve higher purity and remove aggregates

  • Lyophilization: The final product is typically provided as a lyophilized powder

For optimal results, researchers should reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended when aliquoting for long-term storage at -20°C/-80°C to prevent freeze-thaw damage .

How can activity-based protein profiling (ABPP) be applied to study Mb0641c function?

Activity-based protein profiling represents a valuable approach for studying functional aspects of membrane proteins like Mb0641c. Based on methodologies developed for related membrane proteins:

  • Selection of appropriate ABP: Activity-based probes that target conserved catalytic residues in the TVP38/TMEM64 family

  • Competitive ABPP: Using competitive concentration response experiments to assess inhibitor binding and specificity

  • Visualization techniques: Fluorescent gel-based methods to detect active protein fractions

This methodology has been successfully applied to other membrane proteins like DAGL-β, where ABP MB064 was used for profiling enzyme activity across multiple tissues. The method involves incubating membrane proteomes with the probe, followed by visualization via fluorescent labeling .

For Mb0641c specifically, researchers should consider:

  • Identifying the catalytic residues through sequence alignment with related proteins

  • Designing or selecting compatible ABPs based on the active site architecture

  • Validating the approach using recombinant protein before application to native systems

What methodologies are effective for studying Mb0641c's role in calcium signaling pathways?

Given the role of TMEM64 family proteins in calcium signaling, the following methodologies are recommended for investigating Mb0641c's potential involvement in calcium homeostasis:

  • Calcium oscillation assays: Measuring [Ca²⁺]ᵢ oscillations in response to stimuli using fluorescent calcium indicators

  • CaMKIV activation assays: Assessing phosphorylation status of downstream targets

  • Protein-protein interaction studies: Co-immunoprecipitation to identify interactions with calcium transport proteins like SERCA2

  • Mitochondrial ROS measurements: Using mitochondrial ROS-specific dyes (e.g., MitoSOX) to monitor production following stimulation

Research on related protein Tmem64 has demonstrated its role in modulating calcium signaling during RANKL-induced osteoclastogenesis through interaction with SERCA2. Similar approaches can be applied to Mb0641c to determine if it shares functional mechanisms with other family members .

How can homology modeling be utilized to predict structural features of Mb0641c?

Homology modeling represents a powerful approach for predicting the structural features of Mb0641c, especially considering the challenges associated with experimental structure determination of membrane proteins:

  • Template selection: Identify structurally characterized proteins within the TVP38/TMEM64 family or other related membrane proteins with known structures

  • Sequence alignment: Perform multiple sequence alignment to identify conserved regions and potential functional motifs

  • Model building: Generate initial models using software like MODELLER, SWISS-MODEL, or Rosetta

  • Model refinement: Optimize the model through energy minimization and molecular dynamics simulations

  • Validation: Assess model quality using metrics such as RMSD, Ramachandran plots, and QMEAN scores

The refined model can provide insights into:

  • Membrane-spanning regions and topology

  • Potential ligand binding sites

  • Structural basis for protein-protein interactions

  • Mechanistic understanding of calcium transport or modulation

This approach has been successfully applied to other membrane proteins, including DAGL-α, where homology modeling helped identify inhibitor binding sites .

How should researchers interpret contradictory data when studying Mb0641c function across different experimental systems?

When faced with contradictory data regarding Mb0641c function across different experimental systems, consider the following analytical framework:

  • System-dependent factors:

    • Expression system differences (bacterial vs. mammalian)

    • Post-translational modifications present in one system but absent in another

    • Membrane composition variations affecting protein folding and function

  • Methodological considerations:

    • Assay sensitivity and specificity limitations

    • Different detection methods may measure different aspects of function

    • Buffer conditions and presence of detergents can significantly impact membrane protein behavior

  • Resolution strategies:

    • Perform parallel experiments in multiple systems under standardized conditions

    • Utilize complementary techniques to validate findings (e.g., combining biochemical assays with imaging techniques)

    • Consider native expression contexts when interpreting recombinant system data

For example, when studying calcium modulation activities, results from in vitro reconstituted systems may differ from cell-based assays due to the absence of essential cofactors or interacting partners .

What statistical approaches are most appropriate for analyzing experimental data from Mb0641c functional studies?

The appropriate statistical approaches for Mb0641c studies depend on the experimental design and data characteristics:

  • For dose-response experiments:

    • Non-linear regression to determine IC₅₀/EC₅₀ values

    • Comparison of dose-response curves using extra sum-of-squares F test

    • Example: When analyzing inhibition of Mb0641c activity, pIC₅₀ values should be reported with standard error (e.g., pIC₅₀ 7.5 ± 0.07)

  • For comparative studies across tissues or conditions:

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Non-parametric alternatives (Kruskal-Wallis) for non-normally distributed data

  • For time-course experiments (e.g., calcium oscillations):

    • Repeated measures ANOVA

    • Area under curve (AUC) analysis

    • Frequency analysis for oscillatory phenomena

  • For protein-protein interaction studies:

    • Statistical validation through replicate experiments

    • Control for non-specific binding using appropriate negative controls

These approaches have been successfully applied in studies of related proteins like DAGL-α and DAGL-β, where competitive ABPP and enzyme activity assays required robust statistical analysis .

What are the most common challenges in expressing and purifying functional Mb0641c, and how can they be addressed?

Researchers commonly encounter several challenges when working with Mb0641c:

ChallengePotential Solutions
Low expression yieldsOptimize codon usage for expression host; use stronger promoters; adjust induction conditions (temperature, inducer concentration, duration)
Protein aggregationExpress as fusion protein with solubility tags (MBP, SUMO); use specific detergents for membrane protein solubilization; optimize buffer conditions
Improper foldingExpress in eukaryotic systems for complex membrane proteins; include chaperones during expression; optimize refolding protocols if expressed in inclusion bodies
Loss of function during purificationMaintain critical lipids during purification; use milder detergents; perform functional assays at each purification step
Protein instabilityAdd stabilizing agents (glycerol, specific lipids); optimize pH and ionic strength; minimize freeze-thaw cycles

For reconstitution of lyophilized Mb0641c specifically, it's recommended to centrifuge the vial briefly before opening to bring contents to the bottom, and then reconstitute in deionized sterile water. Addition of 5-50% glycerol is advised for long-term storage, with 50% being the default final concentration recommended .

How can researchers effectively study the interaction between Mb0641c and other proteins in calcium signaling pathways?

To effectively study Mb0641c interactions with other proteins in calcium signaling pathways, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use tagged recombinant Mb0641c to pull down interacting partners

    • Perform reciprocal Co-IP to confirm interactions

    • Include appropriate controls (non-specific IgG, protein from knockout systems)

  • Proximity labeling techniques:

    • BioID or TurboID fusion proteins to identify proximal interacting partners

    • APEX2-based proximity labeling in native membrane environments

  • Fluorescence-based interaction assays:

    • FRET (Förster Resonance Energy Transfer) to detect direct protein-protein interactions

    • BiFC (Bimolecular Fluorescence Complementation) for visualizing interactions in living cells

  • Surface Plasmon Resonance (SPR):

    • Quantitative measurement of binding kinetics between purified Mb0641c and potential partners

    • Determination of association and dissociation constants

These approaches can be adapted from studies of related proteins like Tmem64, which was found to interact with SERCA2 and modulate its activity, affecting calcium oscillation during osteoclastogenesis. The interaction between Tmem64 and SERCA2 was crucial for proper calcium signaling and downstream activation of CaMKIV and CREB .

What are the current limitations in our understanding of Mb0641c function, and what research directions might address these gaps?

Current limitations in Mb0641c research and potential research directions include:

  • Structural characterization gaps:

    • Limited high-resolution structural data for Mb0641c

    • Research direction: Apply cryo-EM or X-ray crystallography to solve the structure, potentially using lipid cubic phase crystallization for membrane proteins

  • Functional characterization limitations:

    • Incomplete understanding of physiological role in Mycobacterium bovis

    • Unclear relationship to mammalian TMEM64 despite sequence homology

    • Research direction: Generate knockout strains to assess phenotypic changes; perform comparative functional studies with mammalian homologs

  • Signaling pathway integration:

    • Unknown downstream effectors specific to Mb0641c

    • Research direction: Phosphoproteomics and transcriptomics to identify signaling networks affected by Mb0641c manipulation

  • Translational research potential:

    • Unexplored potential as a drug target for mycobacterial infections

    • Research direction: High-throughput screening for Mb0641c modulators; assess effects of identified compounds on mycobacterial survival

  • Methodological challenges:

    • Difficulty in reconstituting membrane proteins in native-like environments

    • Research direction: Develop nanodiscs or proteoliposomes containing Mb0641c for functional studies in controlled lipid environments

By addressing these research gaps, scientists can develop a more comprehensive understanding of Mb0641c's biological role and potential applications in both basic research and applied contexts .

How does Mb0641c compare structurally and functionally with other members of the TVP38/TMEM64 family?

Comparative analysis of Mb0641c with other TVP38/TMEM64 family members reveals both similarities and differences that can inform research approaches:

  • Structural comparisons:

    • Mb0641c contains the characteristic membrane-spanning domains of the TVP38/TMEM64 family

    • Comparison with mammalian TMEM64 suggests conservation of transmembrane topology despite sequence divergence

    • The protein length (246 aa) is relatively conserved across bacterial TVP38/TMEM64 family members

  • Functional comparisons:

    • Mammalian TMEM64 modulates calcium signaling through interaction with SERCA2

    • TMEM64 in mice regulates osteoclast differentiation via calcium oscillation control

    • Bacterial TVP38/TMEM64 proteins may serve as calcium modulators in prokaryotic systems

  • Evolutionary insights:

    • The presence of this family across diverse organisms suggests fundamental roles in membrane biology

    • Functional adaptations likely occurred during evolution from prokaryotic to eukaryotic systems

Understanding these relationships can inform experimental approaches by allowing researchers to apply methodologies developed for one family member to others, while remaining aware of potential functional divergence .

What techniques can be used to measure Mb0641c activity in comparison to other membrane proteins?

Several techniques can effectively measure Mb0641c activity, drawing from established methods for related membrane proteins:

  • Calcium flux assays:

    • Fluorescent calcium indicators (Fura-2, Fluo-4) to measure changes in intracellular calcium

    • Dual-wavelength ratiometric imaging for quantitative measurements

    • Comparison with known calcium modulators as positive controls

  • ATPase activity assays (if Mb0641c modulates SERCA-like proteins):

    • Colorimetric phosphate release assays

    • Coupled enzyme assays linking ATP hydrolysis to NADH oxidation

    • Radiometric assays with γ-³²P-ATP

  • Electrophysiological techniques:

    • Patch-clamp recordings in reconstituted systems

    • Planar lipid bilayer recordings for channel or transport activity

  • Lipid modification or transfer assays:

    • If Mb0641c functions in lipid transport, fluorescent lipid analogs can track movement

    • ESI-MS/MS analysis of lipid profiles in presence/absence of Mb0641c

These methods have been successfully applied to related membrane proteins such as DAGL-α and DAGL-β, where activity was assessed using substrate assays and competitive ABPP. For Mb0641c specifically, adaptation of these techniques should consider the potential calcium-related activities observed in the TMEM64 family .

How might understanding Mb0641c function contribute to mycobacterial pathogenesis research?

Understanding Mb0641c function could significantly advance mycobacterial pathogenesis research through several avenues:

  • Host-pathogen interactions:

    • If Mb0641c modulates calcium signaling, it may influence host cell calcium homeostasis during infection

    • Potential interference with host signaling pathways could represent a virulence mechanism

  • Survival mechanisms:

    • Membrane proteins often play critical roles in adaptation to host environments

    • Mb0641c may contribute to stress responses or environmental adaptation

  • Drug target potential:

    • As a membrane protein with potential regulatory functions, Mb0641c could represent a novel drug target

    • Structural and functional characterization could enable rational drug design approaches

  • Diagnostic applications:

    • Species-specific epitopes on Mb0641c could be exploited for diagnostic assays

    • Antibodies against Mb0641c might distinguish between mycobacterial species

Research on related bacterial membrane proteins has demonstrated their importance in various aspects of bacterial physiology and pathogenesis, suggesting that detailed characterization of Mb0641c could yield valuable insights into Mycobacterium bovis biology and potentially tuberculosis research .

What emerging technologies might enhance future research on Mb0641c and related membrane proteins?

Several emerging technologies show promise for advancing Mb0641c research:

  • Cryo-electron microscopy advancements:

    • Single-particle cryo-EM for high-resolution structural determination

    • Cryo-electron tomography for visualizing Mb0641c in native membrane environments

  • AlphaFold and deep learning approaches:

    • AI-based structure prediction specifically optimized for membrane proteins

    • Integration of co-evolutionary data to predict functional interactions

  • Genome editing technologies:

    • CRISPR-Cas systems adapted for mycobacteria to generate precise gene modifications

    • Conditional knockdown systems for essential genes

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize Mb0641c distribution and dynamics

    • Correlative light and electron microscopy (CLEM) to link functional data with ultrastructural context

  • Microfluidics and organ-on-chip technologies:

    • Controlled environments for studying Mb0641c function during host-pathogen interactions

    • High-throughput screening platforms for identifying Mb0641c modulators

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.