Recombinant TVP38/TMEM64 family membrane protein Mb1528c (Mb1528c)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene and protein details:

  • Gene Name: BQ2027_MB1528C (synonym: TVP38/TMEM64 family membrane protein Mb1528c) .

Production and Purification

Recombinant Mb1528c is produced in E. coli systems, followed by affinity chromatography using its His tag. Key specifications include:

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
Purity≥85%–90% (verified by SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 50% glycerol

Physicochemical Stability

  • Storage: Long-term storage at -20°C/-80°C; working aliquots stable at 4°C for one week .

  • Stability Notes: Repeated freeze-thaw cycles degrade protein integrity .

TVP38/TMEM64 Family Context

  • Calcium Signaling: Mouse Tmem64 regulates osteoclast differentiation via SERCA2-dependent calcium oscillations . Though not directly studied in M. bovis, this highlights the family’s role in ion transport.

  • Membrane Protein Studies: Mb1528c’s hydrophobic domains make it a candidate for structural studies on bacterial membrane protein dynamics .

Limitations and Future Directions

No peer-reviewed studies directly addressing Mb1528c’s biological role in M. bovis were identified. Current data emphasize its structural properties and availability for technical applications. Future work could explore its interaction with host proteins during mycobacterial infections or its role in bacterial membrane physiology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know and we will prioritize its development.
Synonyms
BQ2027_MB1528C; TVP38/TMEM64 family membrane protein Mb1528c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1528C
Target Protein Sequence
MTAPAICNTTETVHGIATSLGAVARQASLPRIVGTVVGITVLVVVALLVPVPTAVELRDW AKSLGAWFPLAFLLVHTVVTVPPFPRTAFTLAAGLLFGSVVGVFIAVVGSTASAVIAMLL VRATGWQLNSLVRRRAINRLDERLRERGWLAILSLRLIPVVPFAAINYAAGASGVRILSF AWATLAGLLPGTAAVVILGDAFAGSGSPLLILVSVCTGALGLTGLVYEIRNYRRQHRRMP GYDDPVREPALI
Uniprot No.

Target Background

Protein Families
TVP38/TMEM64 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the TVP38/TMEM64 family of membrane proteins?

The TVP38/TMEM64 family represents a group of transmembrane proteins conserved across multiple species, from bacteria to mammals. These proteins typically contain multiple transmembrane domains and are integrated into cellular membranes. In bacterial systems, family members like Mb1528c from Mycobacterium bovis and YdjX from Escherichia coli serve as integral membrane components with predicted roles in membrane organization and cellular compartmentalization . In mammalian systems, TMEM64 functions as a calcium signaling modulator, particularly in bone development processes . The family is characterized by conserved structural motifs rather than specific enzymatic functions, suggesting their roles as scaffolding or regulatory proteins within membrane systems.

How are TVP38/TMEM64 family proteins conserved across species?

Comparative sequence analysis reveals moderate conservation of TVP38/TMEM64 family proteins across diverse species. While bacterial members like Mb1528c (252 amino acids) and E. coli YdjX (236 amino acids) share structural similarities in transmembrane topology, mammalian TMEM64 has evolved specialized functions in calcium signaling . Sequence alignment studies indicate conserved hydrophobic regions corresponding to transmembrane domains, though specific functional motifs vary between prokaryotic and eukaryotic family members. This evolutionary divergence suggests that while core structural elements remain conserved, functional specialization has occurred, particularly in higher organisms where TMEM64 has acquired roles in complex signaling pathways such as osteoclastogenesis regulation .

What expression systems are optimal for producing recombinant Mb1528c?

E. coli represents the predominant expression system for recombinant Mb1528c production due to its efficiency and cost-effectiveness for prokaryotic membrane protein expression . Successful expression typically employs BL21(DE3) or similar strains with expression vectors containing T7 or tac promoters. For optimal yields, induction protocols using IPTG concentrations between 0.1-0.5 mM at reduced temperatures (16-25°C) minimize inclusion body formation while maintaining protein solubility. Alternative expression systems, including cell-free approaches or specialized membrane protein expression strains (C41/C43), may provide advantages for structural studies requiring higher purity or native conformation preservation. Post-expression, purification typically involves immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag, followed by size exclusion chromatography for homogeneity assessment .

How does Mb1528c compare functionally to mammalian TMEM64?

While both belong to the same protein family, Mb1528c from Mycobacterium bovis and mammalian TMEM64 exhibit distinct functional profiles reflective of their evolutionary divergence. Mammalian TMEM64 functions as a positive modulator of osteoclast differentiation through SERCA2-dependent calcium signaling . It physically interacts with sarcoplasmic endoplasmic reticulum Ca²⁺ ATPase 2 (SERCA2) and regulates intracellular calcium oscillations crucial for RANKL-induced osteoclastogenesis . Consequently, TMEM64 deficiency in mammals leads to increased bone mass due to impaired osteoclast formation .

In contrast, the function of bacterial Mb1528c remains less characterized, though structural predictions and localization patterns suggest roles in membrane organization, possibly influencing bacterial cell wall integrity or transport processes . Unlike its mammalian counterpart, no evidence currently links Mb1528c to calcium signaling pathways. This functional divergence likely reflects the different physiological requirements between prokaryotic and eukaryotic systems, with mammalian TMEM64 evolving specialized roles in multicellular tissue development.

What approaches are effective for studying Mb1528c membrane topology?

Determining the precise membrane topology of Mb1528c requires a multi-faceted experimental approach:

  • Computational Prediction: Begin with in silico analysis using topology prediction algorithms (TMHMM, TOPCONS, Phobius) to establish theoretical models of transmembrane domain organization.

  • Cysteine Scanning Mutagenesis: Systematically introduce cysteine residues throughout the protein sequence, followed by membrane-impermeable sulfhydryl reagent labeling to identify exposed versus membrane-embedded regions.

  • PhoA/LacZ Fusion Analysis: Create fusion constructs with alkaline phosphatase (PhoA) or β-galactosidase (LacZ) reporters at various positions to determine cytoplasmic versus periplasmic orientation of specific protein segments.

  • Protease Protection Assays: Expose membrane preparations containing Mb1528c to proteases, analyzing fragment patterns by Western blotting to identify accessible regions.

  • Fluorescence Resonance Energy Transfer (FRET): Employ donor-acceptor fluorescent pairs at predicted intra- and extracellular domains to validate spatial relationships.

  • Cryo-Electron Microscopy: For highest resolution analysis, purify the protein in membrane mimetics (nanodiscs, amphipols) and analyze by cryo-EM to determine three-dimensional structure within the lipid environment.

These complementary approaches collectively provide a comprehensive topological map critical for understanding structure-function relationships in this membrane protein .

How might Mb1528c contribute to Mycobacterium bovis pathogenicity?

While direct evidence linking Mb1528c to Mycobacterium bovis virulence remains limited, several hypothetical pathogenic mechanisms warrant investigation:

  • Cell Envelope Integrity: As a membrane protein, Mb1528c may contribute to the unique mycobacterial cell envelope architecture, potentially influencing permeability to antibiotics or host defense molecules.

  • Environmental Stress Adaptation: TVP38/TMEM64 family proteins could function in stress response pathways, facilitating bacterial survival within the challenging host environment through membrane remodeling.

  • Host-Pathogen Interactions: Mb1528c might participate in adhesion to host cells or in evading host immune surveillance mechanisms through modification of surface-exposed components.

  • Secretion System Function: Some membrane proteins in pathogenic mycobacteria contribute to specialized secretion systems that deliver virulence factors to host cells.

  • Nutrient Acquisition: Membrane proteins often function in transport systems for acquiring essential nutrients within the host environment.

Experimental validation of these hypotheses requires gene knockout/knockdown studies combined with virulence assessment in cellular and animal infection models. Comparative genomics approaches examining Mb1528c conservation and variation across mycobacterial species with different virulence profiles would provide additional insights into potential pathogenicity associations .

What are the challenges in crystallizing membrane proteins like Mb1528c?

Crystallization of membrane proteins like Mb1528c presents numerous technical challenges requiring specialized approaches:

  • Detergent Selection: Identifying detergents that maintain protein stability while extracting it from native membranes represents a critical first step. Systematic screening of detergents (maltosides, glucosides, phosphocholines) is necessary, with n-Dodecyl β-D-maltoside (DDM) and n-Octyl β-D-glucopyranoside (OG) serving as common starting points.

  • Protein Stability: Membrane proteins frequently exhibit decreased stability outside their native lipid environment. Incorporating lipids or cholesterol derivatives during purification can help maintain native conformation.

  • Conformational Heterogeneity: Membrane proteins often adopt multiple conformational states, hindering crystal lattice formation. Ligands, antibody fragments, or conformation-specific nanobodies can stabilize discrete conformations.

  • Crystal Contacts: The detergent micelle surrounding the hydrophobic regions limits potential protein-protein contacts necessary for crystal formation. Increasing the solvent-exposed surface area through fusion partners (T4 lysozyme, BRIL) enhances crystallization probability.

  • Alternative Approaches: When traditional crystallization fails, researchers should consider lipidic cubic phase (LCP) crystallization, which provides a more native-like environment for membrane proteins.

For Mb1528c specifically, recombinant constructs with removable affinity tags following purification will likely yield better crystallization outcomes by reducing flexible regions that interfere with crystal packing .

How can researchers validate proper folding of recombinant Mb1528c?

Validating the proper folding of recombinant Mb1528c requires multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: Compare the secondary structure profile of purified recombinant Mb1528c against theoretical predictions based on amino acid sequence. For transmembrane proteins, characteristic α-helical signatures (negative peaks at 208 and 222 nm) should be evident.

  • Thermal Stability Assays: Employ differential scanning fluorimetry (DSF) or differential scanning calorimetry (DSC) to assess protein stability through melting temperature (Tm) determination. Well-folded membrane proteins typically exhibit cooperative unfolding transitions.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Analyze oligomeric state and homogeneity, as improperly folded membrane proteins often form heterogeneous aggregates.

  • Ligand Binding Assays: If ligands are known or suspected for Mb1528c, binding studies using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can confirm functional integrity.

  • Limited Proteolysis: Properly folded proteins display distinct proteolytic fragment patterns reflecting their structural organization, whereas misfolded proteins typically show rapid and non-specific degradation.

  • Functional Reconstitution: Ultimately, reconstitution of purified Mb1528c into liposomes or nanodiscs, followed by functional assays specific to identified or predicted activities, provides the most definitive validation of proper folding .

What controls should be included when studying Mb1528c localization?

Robust localization studies for Mb1528c require comprehensive controls to ensure accurate interpretation:

  • Subcellular Fractionation Controls:

    • Purity markers for each fraction (e.g., LamB for outer membrane, F1F0-ATPase for inner membrane)

    • Quantitative Western blotting comparing distribution across fractions

    • Density gradient separation with continuous monitoring of marker proteins

  • Fluorescence Microscopy Controls:

    • Co-localization with established compartment markers

    • Controls for fixation artifacts using multiple fixation protocols

    • Live cell imaging with photoconvertible fusion proteins to track dynamics

  • Immunolocalization Controls:

    • Pre-immune serum controls

    • Peptide competition assays to verify antibody specificity

    • Localization in knockout or knockdown strains as negative controls

    • Secondary antibody-only controls

  • Tag Interference Assessment:

    • Comparison of N-terminal versus C-terminal tags

    • Validation with small epitope tags (FLAG, HA) versus fluorescent proteins

    • Demonstration of tagged protein functionality through complementation assays

  • Physiological Relevance:

    • Examination under various growth conditions and stress states

    • Temporal studies throughout growth phases

    • Validation in multiple mycobacterial species

These controls collectively establish confidence in localization findings and prevent misinterpretation due to artifacts or tag-induced mislocalization .

What experimental approaches can identify Mb1528c interaction partners?

Identifying protein interaction partners of Mb1528c requires specialized techniques adapted for membrane proteins:

  • Co-Immunoprecipitation with Crosslinking: Employ membrane-permeable crosslinkers (DSP, formaldehyde) prior to solubilization to capture transient interactions, followed by immunoprecipitation using anti-Mb1528c antibodies or tag-specific antibodies if using tagged recombinant versions.

  • Proximity-Based Labeling: Express Mb1528c fused to enzymes like BioID or APEX2 that biotinylate nearby proteins, allowing streptavidin-based pulldown and mass spectrometry identification of proximity partners.

  • Split-Protein Complementation Assays: Use bacterial two-hybrid systems adapted for membrane proteins (BACTH) or split-GFP approaches to screen potential interaction partners in vivo.

  • Chemical Crosslinking Mass Spectrometry (XL-MS): Apply MS-cleavable crosslinkers to membrane preparations containing Mb1528c, followed by proteolytic digestion and MS analysis to identify crosslinked peptides from interaction partners.

  • Co-purification Studies: Perform tandem affinity purification under gentle solubilization conditions to retain native complexes, with subsequent mass spectrometry identification of co-purifying proteins.

  • Surface Plasmon Resonance (SPR): For candidate interactions, validate and quantify binding kinetics using purified components with Mb1528c immobilized in supported lipid bilayers or nanodiscs.

Data analysis should implement appropriate controls including scrambled/reversed protein sequences, non-specific binding controls, and statistical filtering to distinguish true interactors from contaminants .

How can CRISPR-Cas9 be used to study TVP38/TMEM64 family proteins?

CRISPR-Cas9 methodologies offer powerful approaches for functional analysis of TVP38/TMEM64 family proteins across different organisms:

For Bacterial Systems (Mb1528c):

  • Gene Deletion: Design sgRNAs targeting the Mb1528c coding region with homology-directed repair (HDR) templates containing antibiotic resistance markers for selection of successful knockouts.

  • Promoter Modulation: Target CRISPR interference (CRISPRi) with catalytically dead Cas9 (dCas9) to the promoter region to achieve tunable repression without complete deletion.

  • Epitope Tagging: Use CRISPR-mediated HDR to introduce fluorescent protein or affinity tags at the genomic locus, ensuring native expression levels for localization and interaction studies.

For Mammalian Systems (TMEM64):

  • Knockout Generation: Design multiple sgRNAs targeting early exons of TMEM64 to induce frameshift mutations and functional knockout for phenotypic analysis.

  • Domain Mapping: Create precise mutations in functional domains using base editors or prime editors to avoid complete protein disruption while altering specific functions.

  • Reporter Knock-in: Generate fluorescent reporter knock-ins at the endogenous locus to monitor native expression patterns across tissues and developmental stages.

For both systems, comprehensive validation requires:

  • Off-target analysis using whole-genome sequencing

  • Rescue experiments restoring wild-type phenotypes through complementation

  • Multiplexed targeting of paralogs to address potential functional redundancy

These approaches facilitate detailed functional characterization while maintaining physiological expression contexts essential for accurate assessment of TVP38/TMEM64 family protein functions .

How can researchers reconcile contradictory findings about TVP38/TMEM64 family proteins?

Reconciling contradictory findings about TVP38/TMEM64 family proteins requires systematic evaluation through the following analytical framework:

  • Cross-Species Comparison Analysis: Create a comprehensive table comparing experimental findings across different species, identifying contexts where functions diverge versus those with conserved mechanisms. Parameters should include:

SpeciesProtein NameExperimental SystemReported FunctionInteracting PartnersCellular Localization
M. bovisMb1528cRecombinant expressionMembrane structureTo be determinedCell membrane
E. coliYdjXNative expressionPlasma membrane componentNot reportedPlasma membrane
MammalsTMEM64Knockout miceCa²⁺ oscillation regulationSERCA2Endoplasmic reticulum
  • Methodological Differences Assessment: Compare experimental methodologies, focusing on expression systems (heterologous vs. native), purification approaches, and functional assay conditions that might influence outcomes.

  • Domain-Specific Function Analysis: Examine whether contradictions might reflect domain-specific functions within the same protein, with different studies capturing distinct functional aspects.

  • Environmental Context Evaluation: Consider whether contradictory findings result from different environmental conditions, cellular contexts, or developmental stages in which the proteins were studied.

  • Statistical Reanalysis: When possible, reanalyze raw data from contradictory studies using standardized statistical approaches and effect size calculations rather than simple significance testing.

This structured approach can transform apparent contradictions into complementary insights about context-dependent functions across the TVP38/TMEM64 protein family .

What statistical approaches are appropriate for analyzing structure-function relationships in Mb1528c?

Analyzing structure-function relationships in Mb1528c requires specialized statistical approaches suitable for membrane protein data:

  • Multiple Sequence Alignment Coevolution Analysis: Apply statistical coupling analysis (SCA) or direct coupling analysis (DCA) to identify co-evolving residues within TVP38/TMEM64 family proteins, potentially revealing functionally interacting regions. These approaches measure positional conservation while accounting for the statistical biases inherent in membrane protein sequences.

  • Clustering Methods for Mutational Data: When analyzing the effects of multiple mutations:

    • Hierarchical clustering to identify functionally similar mutants

    • Principal component analysis (PCA) to determine the major dimensions of functional variation

    • K-means clustering for mutation effect classification

  • Regression Approaches for Structure-Function Correlation:

    • Multiple linear regression to correlate structural parameters with functional outcomes

    • Support vector regression for handling non-linear relationships between structure and function

    • Mixed-effects models to account for batch variations in experimental data

  • Bayesian Networks for Causal Inference: Implement Bayesian network analysis to infer causal relationships between structural modifications and functional changes, incorporating prior knowledge about membrane protein folding principles.

  • Cross-Validation Strategy: Employ k-fold cross-validation to assess the predictive power of structure-function models, with testing across multiple experimental datasets to ensure robustness.

These approaches, combined with appropriate visualization techniques such as heat maps for mutagenesis data and network graphs for residue interactions, provide rigorous analysis of structure-function relationships in this challenging protein family .

How should researchers interpret evolutionary conservation patterns within the TVP38/TMEM64 protein family?

Interpreting evolutionary conservation patterns within the TVP38/TMEM64 protein family requires nuanced analysis beyond simple sequence identity measures:

  • Differential Conservation Analysis: Distinguish between bacterial (e.g., Mb1528c, YdjX) and eukaryotic (TMEM64) family members by calculating separate conservation scores for:

    • Transmembrane domains (typically highest conservation)

    • Loop regions (often divergent but may contain lineage-specific functional motifs)

    • N/C-terminal domains (frequently hosting regulatory elements)

  • Rate-Shift Analysis: Implement evolutionary rate-shift analysis to identify regions that have undergone accelerated or constrained evolution in specific lineages, potentially indicating functional specialization.

  • Hydrophobicity Profile Conservation: For membrane proteins, conservation of hydrophobicity patterns often proves more functionally relevant than exact sequence conservation. Generate normalized hydrophobicity profiles across family members to identify conserved membrane-integration patterns despite sequence divergence.

  • 3D Structural Conservation Mapping: When homology models are available, map conservation scores onto predicted three-dimensional structures to identify spatial clusters of conserved residues that may form functional sites despite being disconnected in primary sequence.

  • Correlation with Experimental Data: Integrate conservation analysis with:

Evolutionary PatternFunctional ImplicationExperimental Approach
Universal conservationCore structural/functional roleAlanine scanning mutagenesis
Clade-specific conservationSpecialized functionChimeric protein construction
Correlated mutationsCo-evolving functional unitsDouble mutant cycle analysis
Variable regions flanking conserved coresAdaptation to cellular contextsDomain swapping experiments

This multi-dimensional approach to evolutionary analysis provides insights into functional conservation and divergence that simple sequence comparisons would miss .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.