Recombinant TVP38/TMEM64 family membrane protein Rv0625c/MT0653 (Rv0625c, MT0653)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will then prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us beforehand. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the protein at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Target Names
Rv0625c, MT0653
Target Protein Sequence
MSTHNDSAPTSRRRHIVRLVVFAGFLVGMFYLVAATDVIDVAAVRGAVSATGPAAPLTYV VVSAVLGALFVPGPILAASSGLLFGPLVGVFVTLGATVGTAVVASLVGRRAGRASARALL GGERADRTDALIERCGLWAVVGQRFVPGISDAFASYAFGTFGVPLWQMAVGAFIGSAPRA FAYTALGAAIGDRSPLLASCAIAVWCVTAIIGAFAARHGYRQWRAHARGDGADGGVEDPD REVGAR
Uniprot No.

Q&A

What expression systems are optimal for producing recombinant Rv0625c/MT0653?

For recombinant expression of Rv0625c/MT0653, E. coli-based systems have proven effective with specific conditions:

Expression SystemRecommended ConditionsAdvantages
E. coli BL21(DE3)T7 promoter-based vectors (pET series)High-level protein expression
XL1-BlueFor cloning and screeningStable maintenance of recombinant plasmids
Modified vectorspET3b, pET21b with codon optimizationEnhanced expression of mycobacterial proteins

Induction conditions significantly impact protein quality. Lower temperatures (16-25°C) rather than standard 37°C often result in better folding of membrane proteins. Addition of membrane-mimetic environments or specific chaperones may further enhance proper folding .

What are effective methods for purifying Rv0625c/MT0653 while maintaining native conformation?

Purification of membrane proteins like Rv0625c/MT0653 requires specialized approaches:

  • Membrane isolation: Differential centrifugation to separate bacterial membranes

  • Detergent solubilization: Screening mild detergents (DDM, LMNG, or digitonin) for optimal extraction

  • Affinity chromatography: Using His-tag or other fusion tags for initial purification

  • Size exclusion chromatography: To remove aggregates and obtain homogeneous protein preparations

  • Reconstitution: Transfer into nanodiscs or liposomes for functional studies

For Rv0625c/MT0653, maintaining protein stability requires optimization of buffer conditions with appropriate detergent concentrations, pH (typically 7.0-8.0), and ionic strength .

How can researchers verify successful expression and proper folding of recombinant Rv0625c/MT0653?

Multiple complementary techniques should be employed to verify expression and proper folding:

Verification MethodPurposeTechnical Parameters
SDS-PAGESize verificationExpected MW: ~25-27 kDa
Western blotSpecific detectionUsing anti-tag or custom antibodies
Mass spectrometrySequence confirmationTryptic digest followed by LC-MS/MS
Circular dichroismSecondary structure assessmentFar-UV spectrum (190-260 nm)
Thermal stability assaysFolding assessmentFluorescence-based thermal shift

Native-like folding can be further confirmed through limited proteolysis, which produces characteristic fragmentation patterns in properly folded proteins versus misfolded variants .

What structural features of Rv0625c/MT0653 contribute to its putative membrane protein biogenesis function?

Based on structural comparisons with related proteins in the TVP38/TMEM64 family, Rv0625c/MT0653 likely contains several functional domains:

  • Transmembrane funnel: Similar to TMCO1, it may form a hydrophilic funnel extending across the membrane, facilitating integration of transmembrane segments

  • Lateral gate: Potentially contains regions that open laterally to allow hydrophobic segments to access the lipid bilayer

  • Substrate binding pocket: Hydrophobic cavity that can accommodate transmembrane segments during insertion

These features align with its proposed function in membrane protein biogenesis, potentially as part of a specialized translocon complex in mycobacteria. The structural characteristics suggest it may function similar to the TMCO1 translocon, which is specialized for multi-pass membrane protein integration .

How does the function of Rv0625c/MT0653 compare to other members of the TVP38/TMEM64 family across species?

Comparative analysis reveals functional conservation and specialization:

OrganismTVP38/TMEM64 ProteinFunctionSimilarity to Rv0625c/MT0653
HumanTMCO1Core component of specialized ER translocon for multi-pass proteinsStructural homology in transmembrane organization
HumanTMEM147Forms funnel extending from lumen into membraneSimilar predicted topology
BacteriaYidCMembrane protein insertaseEvolutionary relationship, similar function
EukaryotesGet1Membrane protein insertionShared mechanisms in substrate handling

While human TMCO1 functions in a large complex (~360 kDa) with Sec61, CCDC47, and the Nicalin-TMEM147-NOMO complex, Rv0625c/MT0653 may interact with mycobacterial-specific partners to form a functionally analogous complex adapted to mycobacterial membrane composition .

What methodologies are most effective for investigating the role of Rv0625c/MT0653 in membrane protein biogenesis?

Several complementary approaches can elucidate the function of Rv0625c/MT0653:

  • Genetic approaches:

    • Gene knockout/knockdown with phenotypic analysis

    • Conditional expression systems to study essential functions

    • Complementation studies with mutant variants

  • Biochemical approaches:

    • Co-immunoprecipitation to identify interaction partners

    • In vitro translation systems to study membrane insertion activity

    • Cross-linking mass spectrometry (XL-MS) to map protein interactions

  • Cell biological approaches:

    • Localization studies using fluorescent protein fusions

    • Pulse-chase experiments to track membrane protein maturation

    • Ribosome profiling and RIP-seq to identify client mRNAs

The RIP-seq approach has been particularly informative for related proteins, revealing selective engagement of the TMCO1 translocon with hundreds of different multi-pass membrane proteins .

How can researchers investigate potential client specificity of Rv0625c/MT0653?

To determine which proteins utilize Rv0625c/MT0653 for membrane insertion:

  • RIP-seq analysis: Immunoprecipitation of ribosomes associated with Rv0625c/MT0653 followed by mRNA sequencing can identify client mRNAs, as demonstrated for TMCO1

  • Pulse-chase experiments: Compare maturation kinetics of candidate membrane proteins in wild-type versus Rv0625c-depleted cells

  • Client validation: Monitor levels of candidate clients (e.g., multi-pass transporters) in cells lacking Rv0625c/MT0653, similar to the approach used for EAAT1 in TMCO1 studies

  • In vitro reconstitution: Develop reconstituted systems with purified components to directly test insertion of candidate substrates

A systematic analysis of the M. tuberculosis membrane proteome could identify specific membrane protein classes affected by Rv0625c/MT0653 depletion.

What are the technical challenges in determining the high-resolution structure of Rv0625c/MT0653?

Membrane protein structural determination presents several challenges:

ChallengeTechnical DetailsPotential Solutions
Protein stabilityDetergent-solubilized membrane proteins often destabilizeScreen multiple detergents; use nanodiscs or amphipols
Conformational heterogeneityMultiple functional states complicate structure determinationEngineering stabilized variants; ligand binding to trap states
Crystal formationDetergent micelles hinder crystal contactsLipidic cubic phase crystallization; antibody fragment co-crystallization
Size limitations for cryo-EMSmall membrane proteins (~25-30 kDa) below typical resolution thresholdFusion with larger partners; use of megabodies or nanobodies

The successful structural determination of the TMCO1 translocon complex using cryo-EM suggests that studying Rv0625c/MT0653 in the context of its native complex may be more productive than in isolation .

How can cryo-electron microscopy be optimized for structural studies of Rv0625c/MT0653 complexes?

Based on successful approaches with related proteins:

  • Sample preparation optimization:

    • Use gentle solubilization conditions to maintain native complexes

    • Implement GraFix technique to stabilize large assemblies

    • Consider reconstitution in nanodiscs to better mimic native environment

  • Data collection strategies:

    • Utilize energy filters to enhance contrast

    • Implement multiscale imaging approaches for heterogeneous samples

    • Use Volta phase plates to improve contrast for smaller complexes

  • Processing approaches:

    • Apply 3D classification to separate different conformational states

    • Use focused refinement on specific domains of interest

    • Implement Bayesian polishing and CTF refinement for high-resolution features

This methodology has allowed researchers to successfully determine structures of the TMCO1 translocon at resolutions ranging from ~3.5-4.5 Å for core regions to ~5.5-7.5 Å for membrane regions .

What evidence suggests Rv0625c/MT0653 may be important for M. tuberculosis pathogenesis?

While direct evidence is limited in the search results, several lines of reasoning suggest potential importance:

  • Conservation: The gene is conserved across mycobacterial species, suggesting an essential function

  • Membrane organization: Proper membrane protein biogenesis is critical for virulence factor expression and function

  • Analogous systems: Human TMCO1 translocon is essential for the biogenesis of numerous multi-pass membrane proteins including transporters and receptors

  • Specialized function: The specialized role in multi-pass membrane protein integration suggests non-redundant function that could be essential for pathogen survival

Research methodologies to establish pathogenic relevance would include infection studies comparing wild-type and Rv0625c-deficient strains in macrophage and animal models.

Could Rv0625c/MT0653 represent a viable drug target for anti-tuberculosis therapeutics?

Assessment of drug target potential requires consideration of multiple factors:

CriterionAssessmentEvidence
EssentialityLikely essential based on functionRequires experimental validation through conditional knockdown
DruggabilityModerate - membrane proteins can be targetedContains potential small molecule binding pockets
SelectivityGood - divergence from human homologsStructural differences from human TMCO1/TMEM147
AccessibilityChallenging - inner membrane locationRequires compound penetration through mycobacterial cell wall

Development of high-throughput assays to monitor Rv0625c/MT0653 function would be needed for drug screening efforts. These could include:

  • Reporter systems measuring membrane protein integration efficiency

  • Growth-based assays in conditional knockdown strains

  • Binding assays using purified protein in membrane mimetics

What recombinant expression vectors are recommended for Rv0625c/MT0653 studies?

Several vector systems can be optimized for expression of Rv0625c/MT0653:

  • pET vector series: Particularly pET3b and pET21b, which provide tight regulation and high-level expression under T7 promoter control

  • pGRASS/OLIVAR systems: Novel selection strategies using green fluorescent protein reporter from antisense promoter-based screening, which enable more efficient selection of correctly inserted constructs

  • Specialized membrane protein vectors: Those containing fusion partners known to enhance membrane protein folding and solubility

Recommended modifications include:

  • Codon optimization for E. coli expression

  • Addition of purification tags (His, FLAG) for detection and purification

  • Inclusion of protease cleavage sites for tag removal

  • Incorporation of fluorescent protein fusions for localization studies

What are the optimal storage conditions for working with purified Rv0625c/MT0653?

Based on product information and general practices for membrane proteins:

Storage ConditionRecommended ParametersRationale
Buffer compositionTris-based buffer with 50% glycerolStabilizes protein structure
Short-term storage4°C for up to one weekMinimizes degradation while maintaining accessibility
Long-term storage-20°C or -80°C in aliquotsPrevents repeated freeze-thaw cycles
Additive considerationsDetergent concentration above CMCMaintains micelle integrity around hydrophobic regions
Specialized approachesFlash-freezing in liquid nitrogenMinimizes structural disruption during freezing

Researchers should avoid repeated freeze-thaw cycles as they can lead to protein aggregation and loss of function .

What mass spectrometry approaches are most informative for analyzing Rv0625c/MT0653 interactions and modifications?

Several specialized mass spectrometry techniques provide valuable insights:

  • Crosslinking Mass Spectrometry (XL-MS): Can identify protein-protein interaction interfaces, as demonstrated with the TMCO1 translocon complex

  • Hydrogen-Deuterium Exchange MS (HDX-MS): Provides information on protein dynamics and solvent accessibility of different regions

  • Native MS: Analysis of intact membrane protein complexes to determine stoichiometry and stability

  • Top-down proteomics: Characterization of full-length proteins and their modifications without proteolytic digestion

These techniques should be combined with appropriate membrane protein preparation methods, including specialized detergents or nanodiscs to maintain native-like environments.

How can single-molecule techniques contribute to understanding Rv0625c/MT0653 function?

Single-molecule approaches offer unique insights into dynamic processes:

  • Single-molecule FRET: By labeling different domains of Rv0625c/MT0653, conformational changes during substrate binding and processing can be monitored in real-time

  • Force spectroscopy: Atomic force microscopy or optical tweezers can measure forces associated with membrane protein insertion and folding

  • Single-particle tracking: Following fluorescently labeled Rv0625c/MT0653 in live mycobacterial cells to determine localization and dynamics

  • Patch-clamp electrophysiology: If Rv0625c/MT0653 forms pores or channels, single-channel recordings can characterize conductance properties

These techniques provide mechanistic details impossible to obtain from bulk measurements and can reveal heterogeneity in protein behavior.

How might understanding Rv0625c/MT0653 function impact tuberculosis treatment strategies?

Research on Rv0625c/MT0653 could influence TB treatment in several ways:

  • Novel drug target identification: If validated as essential, Rv0625c/MT0653 could represent a new target class for anti-TB drug development

  • Resistance mechanism insights: Understanding how membrane protein biogenesis affects drug uptake and efflux could explain certain resistance mechanisms

  • Biomarker development: Antibodies against Rv0625c/MT0653 could potentially detect bacterial fragments in patient samples

  • Host-pathogen interaction understanding: If Rv0625c/MT0653 plays a role in presenting virulence factors at the bacterial surface, this could inform vaccine development strategies

Each of these applications requires thorough validation through both basic science and translational research approaches.

What approaches could be used to develop inhibitors targeting Rv0625c/MT0653 function?

A systematic drug discovery pipeline might include:

  • High-throughput screening:

    • Development of functional assays monitoring membrane protein integration

    • Fluorescence-based binding assays with purified protein

    • Growth inhibition in conditional knockdown strains

  • Structure-based drug design:

    • In silico screening against structural models or experimental structures

    • Fragment-based approaches targeting specific functional domains

    • Rational design targeting the substrate binding cavity

  • Peptide-based inhibitors:

    • Design of peptides mimicking transmembrane client segments

    • Cell-penetrating peptides targeting cytoplasmic domains

    • Stapled peptides for enhanced stability and cell penetration

  • Validation strategies:

    • Thermal shift assays confirming direct binding

    • Cryo-EM structures of inhibitor-bound complexes

    • Activity assays with purified components

What are the most promising future research directions for understanding Rv0625c/MT0653 function?

Several key areas warrant further investigation:

  • Client specificity determination: Comprehensive identification of membrane proteins that require Rv0625c/MT0653 for proper biogenesis using RIP-seq and proteomics approaches

  • Structural characterization: High-resolution structures of Rv0625c/MT0653 alone and in complexes with partner proteins and substrates

  • Functional reconstitution: Development of in vitro systems to directly measure membrane protein insertion activity

  • Evolutionary analysis: Comparative studies across mycobacterial species to understand specialized adaptations

  • Integration with stress responses: Investigation of how Rv0625c/MT0653 function changes under different stress conditions relevant to TB pathogenesis

Each of these directions would contribute to a more comprehensive understanding of membrane protein biogenesis in mycobacteria and potential applications in TB treatment.

How might systems biology approaches enhance our understanding of Rv0625c/MT0653 in the context of mycobacterial physiology?

Systems-level approaches offer holistic perspectives:

  • Network analysis:

    • Integration of Rv0625c/MT0653 into protein-protein interaction networks

    • Correlation of expression patterns with other membrane biogenesis factors

    • Prediction of functional relationships through guilt-by-association approaches

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data from Rv0625c/MT0653 perturbation experiments

    • Mapping effects on membrane proteome composition and function

    • Identifying compensatory mechanisms when Rv0625c/MT0653 function is compromised

  • Mathematical modeling:

    • Development of kinetic models of membrane protein biogenesis

    • Prediction of system behavior under different stress conditions

    • Identification of rate-limiting steps in the pathway

These approaches would position Rv0625c/MT0653 within the broader context of mycobacterial physiology and adaptation to host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.