Recombinant TVP38/TMEM64 family membrane protein Rv1491c/MT1538 (Rv1491c, MT1538)

Shipped with Ice Packs
In Stock

Description

Role in Calcium Signaling and Osteoclastogenesis

While Rv1491c/MT1538 is a bacterial protein, studies on its eukaryotic homolog TMEM64 reveal critical insights:

  • Interaction with SERCA2: TMEM64 modulates sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) activity, regulating intracellular Ca²⁺ oscillations essential for osteoclast differentiation .

  • Knockout Phenotype: Tmem64⁻/⁻ mice exhibit increased bone mass due to impaired osteoclast formation and reduced Ca²⁺/calmodulin-dependent kinase IV (CaMKIV) activation .

Functional ComparisonWild-TypeTmem64⁻/⁻
Bone Mineral Density (BMD)NormalIncreased
Osteoclast NumbersNormalReduced by 40–60%
Mitochondrial ROS ProductionRANKL-inducedSuppressed
CREB PhosphorylationActivatedInhibited

Mechanism of Action in Osteoclasts

  1. Calcium Oscillation: TMEM64 stabilizes SERCA2, enabling Ca²⁺ reuptake into the ER, which is critical for generating periodic Ca²⁺ spikes .

  2. Downstream Signaling: Ca²⁺ oscillations activate CaMKIV and mitochondrial ROS, driving CREB phosphorylation and NFATc1 induction—key for osteoclast maturation .

Research Use

  • ELISA Development: Used as an antigen to generate antibodies for detecting TVP38/TMEM64 family proteins .

  • Functional Studies: Employed to investigate membrane protein interactions, calcium signaling, and bacterial pathogenesis mechanisms.

Key Research Findings

  1. SERCA2 Dependency: TMEM64’s role in osteoclastogenesis is contingent on SERCA2 activity; silencing SERCA2 phenocopies Tmem64 deficiency .

  2. Rescue Experiments: Reintroducing TMEM64 into deficient cells restores Ca²⁺ oscillations and osteoclast differentiation .

  3. Dual Tissue Role: While primarily studied in osteoclasts, TMEM64 also influences osteoblast activity, suggesting broader regulatory functions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be defined during production. If you require a specific tag type, please inform us, and we will prioritize developing your specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Target Names
Rv1491c, MT1538
Target Protein Sequence
MTAPAICNTTETVHGIATSLGAVARQASLPRIVGTVVGITVLVVVALLVPVPTAVELRDW AKSLGAWFPLAFLLVHTVVTVPPFPRTAFTLAAGLLFGSVVGVFIAVVGSTASAVIAMLL VRATGWQLNSLVRRRAINRLDERLRERGWLAILSLRLIPVVPFAAINYAAGASGVRILSF AWATLAGLLPGTAAVVILGDAFAGSGSPLLILVSVCTGALGLTGLVYEIRNYRRQHRRMP GYDDPVREPALI
Uniprot No.

Q&A

What is the structural composition of TVP38/TMEM64 family membrane protein Rv1491c/MT1538?

The TVP38/TMEM64 family membrane protein Rv1491c/MT1538 is a 252-amino acid protein that belongs to the tvp38/tmem64 membrane protein family . Current structural predictions suggest it contains multiple transmembrane domains characteristic of membrane proteins. For accurate structural analysis, researchers should employ a combination of computational prediction tools (TMHMM, PSIPRED) and experimental approaches such as circular dichroism spectroscopy to evaluate secondary structure elements.

Hydropathy plot analysis can provide initial insights into potential membrane-spanning regions. For comprehensive structural characterization, consider complementary techniques including:

  • Limited proteolysis to identify domain boundaries

  • Cysteine accessibility assays to determine topology

  • Computational modeling with membrane protein-specific force fields

  • Homology modeling based on structurally characterized homologs

While high-resolution structures are not yet available, predictive modeling suggests alpha-helical transmembrane segments that likely play key roles in the protein's membrane integration and function.

How should researchers approach expression system selection for Rv1491c/MT1538?

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, economical, rapid growthMay lack proper folding for membrane proteinsInitial structural studies, antibody production
Mycobacterial hostsNative-like environment, proper foldingSlower growth, lower yieldsFunctional studies, protein-protein interactions
Cell-free systemsAvoids toxicity issues, direct membrane incorporationExpensive, limited scaleDifficult-to-express constructs, isotope labeling
Yeast systemsEukaryotic processing, scalableDifferent membrane compositionHigher-throughput screening, select functional studies

For optimal expression, consider these methodological approaches:

  • Test multiple construct designs with varying tag positions (N-terminal vs. C-terminal)

  • Evaluate induction conditions systematically (temperature, inducer concentration, duration)

  • Screen different E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

  • Implement controlled expression using tunable promoters to prevent toxicity

These considerations will help establish a reliable expression system that produces functional Rv1491c/MT1538 protein suitable for downstream research applications.

What purification strategies are most effective for recombinant Rv1491c/MT1538?

Purification of recombinant His-tagged Rv1491c/MT1538 requires careful optimization to maintain protein integrity throughout the process. Based on available information, immobilized metal affinity chromatography (IMAC) is the primary purification method leveraging the His-tag . A comprehensive purification strategy should address the challenges specific to membrane proteins.

The following methodological pipeline is recommended:

  • Membrane isolation and solubilization:

    • Test multiple detergents at various concentrations (DDM, LDAO, CHAPS)

    • Optimize solubilization time, temperature, and buffer composition

    • Evaluate detergent:protein ratios to maximize extraction efficiency

  • Affinity chromatography optimization:

    • Implement step-wise imidazole gradients (20-50-250 mM)

    • Maintain detergent above critical micelle concentration throughout

    • Consider adding glycerol (10-15%) to enhance stability

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for charge variant separation

    • Detergent exchange if required for downstream applications

Monitor purification quality at each step through SDS-PAGE, Western blotting, and activity assays if available. For membrane proteins like Rv1491c/MT1538, maintaining a stable membrane-mimetic environment throughout purification is critical for retaining native-like structure and function.

What approaches should be used to investigate the function of Rv1491c/MT1538?

Understanding the function of Rv1491c/MT1538 requires a multi-faceted approach that combines genetic, biochemical, and structural methods. Current information about specific pathways and functions of this protein is limited , necessitating systematic investigation strategies.

For comprehensive functional characterization, implement the following methodological framework:

  • Comparative genomics approaches:

    • Phylogenetic analysis across mycobacterial species

    • Identification of conserved domains and motifs

    • Co-evolution analysis to predict functional partners

    • Genomic context examination for operon structures

  • Genetic manipulation techniques:

    • Gene knockout or knockdown studies with phenotypic analysis

    • Complementation assays to confirm gene-phenotype relationships

    • Conditional expression systems to study essential functions

    • Promoter reporter fusions to identify expression conditions

  • Biochemical and biophysical approaches:

    • Lipid binding assays using fluorescence anisotropy

    • Reconstitution in proteoliposomes for functional studies

    • Activity assays based on predicted biochemical functions

    • Structural studies correlated with functional measurements

These methods should be applied iteratively, with each round of experiments informing subsequent investigations to gradually build a comprehensive understanding of Rv1491c/MT1538 function.

How can researchers effectively study protein-protein interactions involving Rv1491c/MT1538?

Investigating protein-protein interactions (PPIs) for membrane proteins like Rv1491c/MT1538 presents unique challenges. Currently, specific interacting proteins for Rv1491c/MT1538 have not been extensively characterized . A systematic approach to identifying and validating interaction partners should include multiple complementary techniques.

MethodTechnical ApproachAdvantagesLimitations
Pull-down assaysImmobilize His-tagged Rv1491c/MT1538 on Ni-NTA, incubate with cell lysate, identify binding partners by MSIdentifies native interactions, suitable for membrane proteinsRequires optimization of detergent conditions
Bacterial two-hybridExpress bait/prey fusion constructs, monitor reporter gene activationIn vivo detection, relatively simpleMay miss interactions dependent on membrane environment
Cross-linking MSChemical cross-linking followed by MS identificationCaptures transient interactions, identifies interaction interfacesComplex data analysis, requires optimization
FRET/BRETExpress fluorophore-tagged constructs, measure energy transferReal-time monitoring in cells, detects dynamic interactionsRequires careful controls, tag may interfere with function
Co-immunoprecipitationPrecipitate with specific antibodies, identify complexesDetects native complexesRequires specific antibodies, may disrupt weak interactions

For rigorous validation of interactions:

  • Confirm interactions using at least two independent methods

  • Perform reciprocal experiments (e.g., pull-down with both proteins as bait)

  • Map interaction domains through truncation or mutation analysis

  • Assess biological relevance through co-localization and functional studies

These methodological considerations will help establish reliable protein-protein interaction networks for Rv1491c/MT1538.

What experimental design considerations are important for studying membrane topology of Rv1491c/MT1538?

Determining the membrane topology of Rv1491c/MT1538 is crucial for understanding its function and interactions. As a membrane protein of 252 amino acids , establishing how it orients within the membrane requires specialized experimental approaches.

A comprehensive topology mapping strategy should include:

When designing these experiments, researchers should:

  • Create multiple independent lines of evidence

  • Address potential artifacts from tags or reporter systems

  • Compare results in different membrane environments

  • Consider native vs. recombinant protein differences

This systematic approach will help establish a reliable topology model for Rv1491c/MT1538, providing crucial insights into its structural organization and functional mechanisms.

What are the optimal conditions for crystallization trials of Rv1491c/MT1538?

Crystallizing membrane proteins like Rv1491c/MT1538 presents significant challenges requiring specialized approaches. While no crystallization conditions are specifically reported for this protein , researchers should implement systematic screening protocols optimized for membrane proteins.

For crystallization of Rv1491c/MT1538, consider the following methodological framework:

  • Pre-crystallization optimization:

    • Assess protein homogeneity by size exclusion chromatography

    • Verify monodispersity using dynamic light scattering

    • Perform thermal stability assays to identify stabilizing conditions

    • Evaluate detergent screening using microscale thermophoresis

  • Crystallization method selection:

    • Vapor diffusion (hanging/sitting drop) as initial approach

    • Lipidic cubic phase for transmembrane region stabilization

    • Bicelle-based crystallization for native-like environment

    • Antibody fragment co-crystallization to provide crystal contacts

  • Systematic parameter optimization:

    • Detergent type and concentration screening

    • Lipid:protein ratio titration if using lipidic methods

    • PEG molecular weight and concentration gradients

    • pH range exploration (typically pH 5.5-8.5)

  • Advanced techniques for challenging targets:

    • Surface entropy reduction through mutation

    • Truncation construct design guided by limited proteolysis

    • Fusion protein approaches (T4 lysozyme, BRIL)

    • In situ diffraction of microcrystals

Document all conditions systematically, including detailed recipes, incubation temperatures, and observed outcomes. For membrane proteins like Rv1491c/MT1538, successful crystallization often requires hundreds of conditions to be screened before identifying promising leads for optimization.

How should researchers approach structural studies of Rv1491c/MT1538 using cryo-electron microscopy?

Cryo-electron microscopy (cryo-EM) offers advantages for structural characterization of membrane proteins like Rv1491c/MT1538 that may be difficult to crystallize. A methodical approach to cryo-EM studies should address the specific challenges of this 252-amino acid membrane protein .

The following workflow is recommended for cryo-EM studies:

  • Sample preparation optimization:

    • Evaluate protein stability in different detergents

    • Test reconstitution in nanodiscs or amphipols

    • Optimize protein concentration (typically 0.5-5 mg/mL)

    • Assess sample homogeneity by negative stain EM before proceeding

  • Vitrification parameter development:

    • Grid type selection (Quantifoil, C-flat, UltrAuFoil)

    • Glow discharge or plasma cleaning optimization

    • Blotting time and force calibration

    • Vitrification temperature adjustment

  • Data collection strategy:

    • Defocus range determination (-0.8 to -2.5 μm typical)

    • Exposure time and electron dose optimization

    • Collection scheme development (beam shift vs. stage movement)

    • Frame rate and motion correction parameters

  • Image processing considerations:

    • 2D classification to identify protein orientations

    • Ab initio model generation without reference bias

    • 3D classification to separate conformational states

    • Local resolution estimation and focused refinement

For challenging membrane proteins like Rv1491c/MT1538, consider:

  • Using Fabs or other binding partners to increase particle size

  • Implementing symmetry-based reconstruction if applicable

  • Employing density modification for map improvement

  • Integrating complementary techniques (e.g., crosslinking MS data)

These methodological considerations will maximize the likelihood of obtaining high-resolution structural information for Rv1491c/MT1538 using cryo-EM.

What NMR spectroscopy approaches are suitable for analyzing Rv1491c/MT1538 structure and dynamics?

Nuclear Magnetic Resonance (NMR) spectroscopy offers unique insights into both structural and dynamic properties of membrane proteins like Rv1491c/MT1538. For this 252-amino acid protein , specialized NMR approaches are required to address size limitations and membrane environment challenges.

A comprehensive NMR investigation strategy should include:

  • Sample preparation considerations:

    • Isotopic labeling schemes (15N, 13C, 2H) optimized for membrane proteins

    • Expression in minimal media with labeled precursors

    • Detergent micelle optimization for spectral quality

    • Bicelle or nanodisc reconstitution for native-like environment

  • Experimental approach selection based on research questions:

NMR ExperimentInformation ObtainedApplication to Rv1491c/MT1538
HSQC/TROSYBackbone assignments, binding sitesInitial characterization, ligand screening
NOESY-based methodsDistance restraints for structureSecondary structure determination
Relaxation measurementsDynamics on ps-ns timescaleFlexible regions identification
Residual dipolar couplingsOrientational constraintsHelix packing and orientation
Solid-state NMRStructure in membrane environmentNative-like structural analysis
  • Data analysis workflow:

    • Chemical shift assignment strategies for membrane proteins

    • Integration with computational modeling approaches

    • Structure calculation with membrane-specific restraints

    • Validation against complementary structural data

  • Specialized techniques for challenging regions:

    • Selective labeling to reduce spectral complexity

    • Paramagnetic relaxation enhancement for long-range constraints

    • Exchange-transferred experiments for transient interactions

    • Fragment-based approaches for domain-specific analysis

These methodological considerations will help researchers design effective NMR experiments for structural and dynamic characterization of Rv1491c/MT1538, even with the challenges inherent to membrane protein analysis.

How can site-directed mutagenesis be optimally designed to probe structure-function relationships in Rv1491c/MT1538?

Site-directed mutagenesis provides powerful insights into structure-function relationships of proteins like Rv1491c/MT1538. A systematic mutagenesis strategy should be designed to target key residues with the potential to impact structure, function, or interactions.

For effective mutagenesis studies of Rv1491c/MT1538, implement the following methodological framework:

  • Target residue selection strategy:

    • Conserved amino acids identified through multiple sequence alignment

    • Predicted functional sites from computational analysis

    • Residues at predicted membrane interfaces

    • Putative interaction sites based on structural models

    • Charged residues within transmembrane domains (often functionally critical)

  • Mutation design principles:

    • Conservative substitutions (maintaining physicochemical properties)

    • Non-conservative substitutions (altering charge, hydrophobicity)

    • Alanine scanning of specific regions (minimizes steric effects)

    • Cysteine introduction for site-specific labeling experiments

    • Serine/threonine mutations to assess phosphorylation site importance

  • Functional assessment of mutants:

    • Expression level and localization analysis

    • Protein stability and folding evaluation

    • Membrane integration assessment

    • Interaction partner binding assays

    • Activity assays based on predicted function

  • Structural impact analysis:

    • Circular dichroism to assess secondary structure alterations

    • Thermal stability comparison with wild-type

    • Detergent solubility profile changes

    • Conformational flexibility differences

This comprehensive approach will establish clear connections between specific amino acid residues and their roles in Rv1491c/MT1538 structure and function, providing mechanistic insights into this membrane protein.

What computational approaches complement experimental studies of Rv1491c/MT1538?

Computational methods provide valuable insights that guide and enhance experimental studies of Rv1491c/MT1538. For this 252-amino acid membrane protein , integrative computational approaches can predict structural features, functional sites, and interaction partners.

A comprehensive computational strategy should include:

These computational approaches should be implemented iteratively with experimental validation, creating a feedback loop where computational predictions guide experiments, and experimental results refine computational models.

How should researchers design experiments to study post-translational modifications of Rv1491c/MT1538?

Post-translational modifications (PTMs) can significantly impact the function, localization, and interactions of membrane proteins like Rv1491c/MT1538. While specific PTMs for this protein have not been extensively characterized , a systematic approach to their identification and functional analysis is essential.

For comprehensive PTM characterization, implement the following experimental strategy:

  • Prediction and prioritization of potential PTMs:

    • Phosphorylation site prediction (NetPhos, GPS)

    • Glycosylation site analysis if expressed in eukaryotic systems

    • Lipid modification prediction for membrane proteins

    • Methylation, acetylation, and other PTM site scanning

  • Detection and mapping methods:

PTM TypeDetection MethodTechnical Considerations
PhosphorylationPhospho-specific antibodies, Pro-Q Diamond staining, MS/MSEnrichment steps critical for low abundance sites
GlycosylationLectin blotting, PNGase F treatment, Glycoprotein stainingSite mapping requires specialized MS approaches
LipidationMetabolic labeling, Click chemistry, MS analysisMaintenance of hydrophobic modifications during processing
UbiquitinationWestern blotting, MS/MS, UbiSiteSample preparation to preserve this labile modification
  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Analysis of modification dynamics under different conditions

    • Comparison of modified vs. unmodified protein properties

    • Interaction partner differences based on modification state

  • Regulatory mechanism investigation:

    • Identification of enzymes responsible for modifications

    • Temporal analysis of modification patterns

    • Stimulus-dependent changes in modification profiles

    • Cross-talk analysis between different modification types

These methodological approaches will establish both the presence and functional significance of post-translational modifications on Rv1491c/MT1538, providing insights into regulatory mechanisms affecting this membrane protein.

What are common challenges in expressing Rv1491c/MT1538 and how can they be addressed?

Expression of membrane proteins like Rv1491c/MT1538 frequently encounters specific challenges that require systematic troubleshooting. While E. coli has been successfully used as an expression host , researchers should be prepared to address common issues through methodical optimization.

ChallengePotential CausesSolutions
Low expression yieldToxicity to host, poor codon usageUse tightly controlled inducible promoters, codon optimization, lower temperature induction
Inclusion body formationImproper folding, aggregationAdd fusion partners (MBP, SUMO), co-express chaperones, optimize induction parameters
Proteolytic degradationInstability, exposed cleavage sitesUse protease-deficient strains, optimize buffer composition, add protease inhibitors
Poor membrane integrationOverloading membrane machineryReduce expression rate, co-express membrane insertion machinery, use specialized strains (C41/C43)
Heterogeneous productMultiple conformations, partial processingOptimize solubilization conditions, implement additional purification steps

When troubleshooting expression issues:

  • Implement parallel optimization using design of experiments (DoE) approach

  • Test multiple construct designs simultaneously (varying tags, linkers)

  • Establish quantitative metrics for expression success

  • Maintain detailed records of all conditions and outcomes

  • Consider alternative expression systems if E. coli proves unsuitable

These systematic approaches to troubleshooting will help overcome expression challenges and establish reliable protocols for producing sufficient quantities of properly folded Rv1491c/MT1538 for downstream research applications.

How can researchers confirm the structural integrity of purified Rv1491c/MT1538?

Ensuring that purified Rv1491c/MT1538 maintains its structural integrity is critical for obtaining reliable research results. Multiple complementary methods should be employed to verify that the recombinant protein retains its native-like structure after expression and purification .

A comprehensive structural integrity assessment should include:

  • Basic characterization:

    • SDS-PAGE for molecular weight confirmation

    • Size exclusion chromatography for monodispersity analysis

    • Mass spectrometry for accurate mass determination

    • N-terminal sequencing to verify intact protein

  • Secondary structure evaluation:

    • Circular dichroism spectroscopy for secondary structure content

    • FTIR spectroscopy for membrane protein-specific analysis

    • Thermal denaturation to assess stability

    • Limited proteolysis for domain integrity assessment

  • Tertiary structure verification:

    • Tryptophan fluorescence for tertiary fold characterization

    • Cysteine accessibility assays for structural exposure

    • Binding assays for known ligands or antibodies

    • Comparison with predicted structural features

  • Functional validation:

    • Activity assays if function is known

    • Interaction with established binding partners

    • Reconstitution studies in artificial membranes

    • Complementation of knockout phenotypes if possible

This multi-faceted approach provides confidence that purified Rv1491c/MT1538 maintains its structural integrity, allowing researchers to conduct downstream experiments with properly folded, functionally relevant protein.

What strategies can improve reproducibility in Rv1491c/MT1538 research?

Reproducibility is a critical concern in membrane protein research, particularly for proteins like Rv1491c/MT1538 where standardized protocols may not be widely established. Implementing robust reproducibility practices ensures that research findings are reliable and can be built upon by the scientific community.

To enhance reproducibility in Rv1491c/MT1538 research:

  • Standardize expression and purification protocols:

    • Document complete protocols with precise reagent information

    • Specify exact buffer compositions and preparation methods

    • Define quantitative quality control metrics and acceptance criteria

    • Establish protein batch validation procedures

  • Implement consistent characterization methods:

    • Use multiple orthogonal techniques for critical measurements

    • Include appropriate positive and negative controls

    • Develop standard operating procedures for common assays

    • Establish calibration protocols for instruments

  • Enhance data management and reporting:

    • Maintain comprehensive electronic laboratory notebooks

    • Implement consistent data organization structures

    • Document all experimental parameters including environmental conditions

    • Report both successful and failed experiments

  • Adopt open science practices:

    • Share constructs through repositories (Addgene, BEI Resources)

    • Deposit primary data in appropriate databases

    • Provide detailed methods in publications with no omissions

    • Make analysis scripts and workflows publicly available

By implementing these reproducibility-enhancing strategies, researchers can establish a more robust foundation for Rv1491c/MT1538 studies, facilitating scientific progress and collaboration within the research community.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.