Recombinant TWiK family of potassium channels protein 18 (twk-18)

Shipped with Ice Packs
In Stock

Description

Electrophysiological Behavior

TWK-18 exhibits unique biophysical characteristics:

  • Temperature sensitivity: Currents increase dramatically with rising temperatures .

  • Rectification: Outwardly rectifying potassium currents .

  • Ion selectivity: Highly selective for K⁺ over Na⁺ (reversal potentials align with K⁺ equilibrium) .

Table 1: Comparative Electrophysiology of Wild-Type vs. Mutant TWK-18

ParameterWild-Type TWK-18TWK-18(e1913)TWK-18(cn110)
Mean current at 25°C0.7 ± 0.37 μA23.7 ± 6.5 μA3.3 ± 1.0 μA
Rectification patternOutwardOutwardOutward
Temperature activationModerateHyperactiveIntermediate

Data sourced from

Mutant Phenotypes

Gain-of-function mutations (e.g., e1913, cn110) cause:

  • Paralysis and uncoordinated movement in C. elegans due to muscle hyperpolarization .

  • Embryonic lethality at the two-fold stage .

Expression and Localization

  • Tissue specificity: Expressed in body wall muscle, as shown by promoter-GFP fusion experiments .

  • Functional redundancy: Loss-of-function mutants show no overt phenotypes, suggesting redundancy with other TWK channels .

Mechanistic Studies

  • Temperature-gated channels: TWK-18 serves as a model for studying thermal sensitivity in K2P channels .

  • Ion selectivity modulation: Used to investigate Na⁺ permeability under low K⁺ conditions, relevant to human K2P homologs like TWIK1 .

Genetic and Pharmacological Tools

  • Antibodies: Polyclonal antibodies (e.g., Rabbit anti-TWK-18) enable Western blot and ELISA applications .

  • Mutant analysis: Gain-of-function variants (e.g., L428F in UNC-58) help dissect gating mechanisms in K2P channels .

Evolutionary and Functional Significance

  • Conserved gating mechanisms: Residues like TM2.6 (e.g., Gly-159 in TWK-18) modulate channel activity across species .

  • Behavioral modulation: TWK-18 interacts genetically with other twk genes (e.g., twk-2, twk-7) to regulate locomotion and muscle contraction .

Future Directions

  • Structural studies: Cryo-EM analysis to resolve temperature-dependent conformational changes.

  • Therapeutic potential: Exploring TWK-18 homologs in human diseases linked to potassium channel dysfunction.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
twk-18; C24A3.6; TWiK family of potassium channels protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
twk-18
Target Protein Sequence
MAIVAQGVSTILTTFQKTFKGLLPLIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDE LIRRTVYKINQLQIKRQRRLMTAEEEYNRTAKVLTTFQETLGIVPADMDKDIHWTFLGSI FYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRFFL KSTRVVSKDLSNKISEAADNIEEGTTAITPSAEKTENNDDDLLSFPISGLLLITVIWVIF CAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPSDYDFMPIVGVLLLIGLSLVSTVMTL IQQQIEALASGMKDNIDQEYARALNEAREDGEVDEHVDPEEDPENNKKSFDAVISRMNWS KRGLYYLLPDSQKKELAKQSEKKMGRKSIKIQTDNDLLETLIREEILKAELNNEMHKYTA PRSSHQPKLVYSDVREKEVPIEVVRVEHFNHGNEDYLEHDI
Uniprot No.

Target Background

Function
Outwardly rectifying potassium channel protein. Its activity is significantly enhanced by increases in temperature.
Database Links

KEGG: cel:CELE_C24A3.6

STRING: 6239.C24A3.6.2

UniGene: Cel.7698

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in body wall muscle.

Q&A

What is TWK-18 and how does it differ from other potassium channels?

TWK-18 belongs to the TWK (two-P domain K+) family of potassium channel subunits that contain two pore regions and four transmembrane domains per subunit . Unlike the more common potassium channels that span the membrane either two or six times with a single P region per subunit, TWK channels have a distinctive topology with four transmembrane segments and two P regions per subunit . Studies from mammalian TWK channels suggest that members of this class associate as dimers, in contrast to other structural classes of potassium channels that form as tetramers . This structural difference is significant as it affects how the channels assemble and potentially influences their gating properties and regulation mechanisms. The TWK family is widely represented in C. elegans, with at least 42 genes encoding TWK channels in its genome, making it an excellent model system for studying this channel class .

How is the TWK-18 gene structured and what domains are critical for its function?

The TWK-18 gene was initially predicted by Genefinder to be two separate adjacent genes in cosmid C24A3, but sequence data from a C. elegans EST (yk305H4) indicated that these two gene predictions together encode the complete TWK-18 channel . The protein contains four transmembrane domains with two pore-forming P-loop regions that contain the highly conserved K+ selectivity filter sequence typically represented as GYGD, which is critical for potassium selectivity . The second transmembrane segment (M2) contains a conserved glycine residue that, when mutated to aspartate in the twk-18(e1913) allele, causes significant changes in channel function . The full protein structure includes both the transmembrane domains that form the channel pore and cytoplasmic regions that are likely involved in regulation, protein-protein interactions, and potentially temperature sensing. Understanding these domains is essential for interpreting how mutations affect channel function and for designing experiments to probe specific aspects of channel activity.

What is the physiological role of TWK-18 in normal cellular function?

TWK-18 functions as a temperature-sensitive potassium channel primarily expressed in the body wall muscle of C. elegans, as demonstrated through promoter-green fluorescent protein fusion experiments . Under normal physiological conditions, TWK-18 helps maintain resting membrane potential by allowing potassium ions to flow out of the cell, thus contributing to muscle excitability and coordination of movement in the nematode. The channel's temperature sensitivity suggests it may play a role in adaptation to environmental temperature changes, potentially serving as a molecular thermosensor in muscle tissue. As potassium channels generally function to repolarize excitable cells after action potentials, TWK-18 likely contributes to the rhythmic contractions of body wall muscles required for sinusoidal movement in C. elegans. The channel's regulation through temperature provides a fascinating example of how ion channels can transduce physical stimuli into altered cellular electrical activity.

How does temperature affect TWK-18 channel activity and what mechanisms underlie this sensitivity?

TWK-18 exhibits dramatic increases in current with rising temperature, making it distinctly temperature-sensitive compared to many other potassium channels . This temperature dependence could arise from conformational changes in the channel protein that alter open probability, single-channel conductance, or both. Experimental data from expression studies in Xenopus oocytes have demonstrated that temperature directly modulates channel activity, with increased temperatures resulting in significantly larger potassium currents . The molecular basis for this temperature sensitivity likely involves specific amino acid residues or domains that undergo conformational changes in response to thermal energy. Potential mechanisms include alterations in membrane fluidity affecting channel conformation, temperature-dependent protein-protein interactions, or direct effects on the channel gating machinery. Understanding these mechanisms requires detailed structure-function studies combining mutagenesis, electrophysiological recording at different temperatures, and potentially structural biology approaches.

What phenotypic effects do TWK-18 mutations produce in C. elegans?

Mutations in the twk-18 gene result in pronounced motor defects in C. elegans, with affected animals displaying uncoordinated movement and paralysis . Two mutant alleles of twk-18 have been characterized, both conferring movement abnormalities that reflect altered muscle excitability. Expression studies in Xenopus oocytes revealed that these mutant channels express much larger potassium currents than wild-type channels, suggesting a gain-of-function mechanism . This increased channel activity would hyperpolarize muscle cells, reducing their excitability and impairing coordinated contraction. The severity of the movement defect likely correlates with the degree of channel hyperactivity, with temperature potentially exacerbating the phenotype due to the channel's inherent temperature sensitivity. These characteristics make twk-18 mutants valuable models for studying how ion channel dysfunction leads to motor disorders and for testing potential therapeutic approaches that might restore normal channel function or compensate for the altered muscle excitability.

How does the twk-18(e1913) mutation alter channel function at the molecular level?

The twk-18(e1913) mutation substitutes an aspartate for a conserved glycine (G→D) at the base of the second transmembrane segment (M2) of the channel . This single amino acid change profoundly affects channel function, resulting in significantly larger potassium currents compared to wild-type TWK-18 . The increased current likely stems from altered channel gating, potentially increasing open probability, mean open time, or single-channel conductance. Electrophysiological studies in Xenopus oocytes have allowed detailed characterization of these parameters through inside-out macropatch recordings and single-channel analyses . The glycine residue mutated in e1913 is highly conserved across potassium channels and likely provides flexibility at a critical gating region of the channel. Replacing this small, neutral amino acid with a negatively charged aspartate could disrupt normal channel closure, leading to channels that remain open longer or open more frequently. This molecular understanding helps explain why the mutation produces a gain-of-function effect and the resulting paralysis phenotype in affected worms.

What expression systems are optimal for studying recombinant TWK-18 channels?

Xenopus laevis oocytes have proven effective for functional expression and characterization of TWK-18 channels, as demonstrated in the original functional characterization studies . This expression system offers several advantages for ion channel research, including large cell size that facilitates electrophysiological recording, robust protein translation machinery for heterologous expression, and minimal endogenous channel expression that could confound results. For TWK-18 expression, the channel cDNA is typically subcloned into an appropriate vector (such as pOX) designed for oocyte expression and confirmed by sequencing . RNA is then synthesized in vitro and injected into defolliculated oocytes, with functional expression typically assessed after 2-3 days. Alternative expression systems, such as mammalian cell lines (HEK293, CHO), might also be suitable for certain applications, particularly those requiring mammalian post-translational modifications or for high-throughput screening approaches. Each expression system has distinct advantages and limitations that should be considered based on the specific experimental questions being addressed.

How can TWK-18 be used as a model for studying temperature-sensitive ion channel gating?

TWK-18 provides an excellent model system for investigating temperature-sensitive gating mechanisms in ion channels due to its pronounced response to temperature changes . Researchers can exploit this property through structure-function studies that identify domains or specific residues responsible for temperature sensing. Chimeric constructs combining regions of TWK-18 with temperature-insensitive channels can help localize the temperature-sensing domains. Site-directed mutagenesis targeting conserved residues, particularly in transmembrane domains or pore regions, can reveal amino acids critical for temperature sensitivity. Advanced electrophysiological protocols combining temperature jumps with voltage protocols can characterize the kinetics and thermodynamics of temperature-dependent gating. Molecular dynamics simulations based on channel structure may provide insights into how temperature affects protein conformation and dynamics. These approaches collectively offer a powerful platform for understanding not only TWK-18 function but also general principles of how ion channels sense and respond to temperature changes, with potential applications to other temperature-sensitive channels including those relevant to pain sensation and fever response in mammals.

What are the experimental challenges in distinguishing direct temperature effects from indirect cellular responses when studying TWK-18?

Distinguishing direct temperature effects on TWK-18 from indirect cellular responses presents several experimental challenges requiring careful controls and specialized techniques. Cell-free patch recordings (excised patches) can isolate the channel from cytoplasmic signaling cascades, helping determine whether temperature sensitivity is an intrinsic channel property or requires cellular components . Rapid temperature changes during recording can separate direct effects from slower secondary responses mediated by signaling pathways or metabolic changes. Pharmacological tools that block specific signaling pathways can help identify any indirect mechanisms contributing to temperature responses. Heterologous expression in different cell types with distinct signaling machinery can reveal cell-specific modulation of temperature effects. Temperature sensitivity should be quantified using Arrhenius plots and Q₁₀ values to characterize the energetics of temperature dependence and compare with other temperature-sensitive processes. Additionally, researchers must account for temperature effects on recording equipment and solutions, which can introduce artifacts. Addressing these challenges requires sophisticated temperature control systems, careful experimental design, and appropriate analytical frameworks to separate direct channel modulation from indirect cellular effects.

What evolutionary insights can be gained from studying the diverse TWK channel family in C. elegans?

The expansive TWK channel family in C. elegans, with at least 42 members, provides a remarkable system for studying evolutionary diversification of ion channels . This large gene family likely arose through multiple gene duplication events followed by functional diversification, creating channels with specialized properties and expression patterns tailored to specific physiological roles. Comparative genomic analyses across nematode species can reveal evolutionary conservation and divergence patterns, identifying core functional domains versus rapidly evolving regions. Functional characterization of multiple TWK family members, beyond the temperature-sensitive TWK-18, may uncover diverse sensory capabilities responding to different stimuli (mechanical, chemical, thermal). The specialization of TWK channels in C. elegans potentially compensates for the relatively compact genome and limited cell number, allowing sophisticated sensory and motor functions with fewer cell types than in more complex organisms. Phylogenetic analysis of the TWK family can reconstruct the evolutionary history of these channels and potentially identify ancestral functions. Understanding this channel diversity offers insights into how ion channel families evolve novel properties and how organisms adapt their electrical signaling systems to environmental challenges, with potential relevance to understanding ion channel evolution across metazoan lineages.

How should factorial experimental designs be implemented for studying TWK-18 modulation by multiple factors?

Factorial experimental designs are particularly valuable for studying TWK-18 modulation as they allow simultaneous evaluation of multiple factors affecting channel function . When investigating TWK-18, researchers might consider factors such as temperature, membrane voltage, extracellular/intracellular ion concentrations, and pharmacological agents. A comprehensive two-by-three factorial design could examine two temperature conditions (e.g., 20°C and 30°C) across three different membrane potentials (-80mV, 0mV, +80mV) to characterize how voltage-dependence changes with temperature . This approach would enable assessment of both main effects (the average effect of temperature across all voltage conditions and vice versa) and interaction effects (how temperature specifically alters voltage-dependent behaviors) . The experimental setup should include randomization of condition order when possible to minimize systematic errors. Data analysis should calculate both average treatment effects (ATEs) and conditional average treatment effects (CATEs) to fully characterize factor interactions . Power analysis prior to experimentation should ensure sufficient replication to detect expected effect sizes, particularly for interaction terms which typically require larger sample sizes. This factorial approach provides a more comprehensive understanding of channel modulation than single-factor experiments and can reveal complex regulatory relationships that might otherwise be overlooked.

What controls and validation steps are essential when characterizing new TWK-18 mutants?

Rigorous characterization of new TWK-18 mutants requires multiple controls and validation steps to ensure reliable interpretation of altered channel function . The experimental workflow should begin with sequence verification of the mutant construct to confirm the intended mutation is present without additional unintended changes. Expression levels should be quantified using techniques such as Western blotting or surface expression assays to ensure differences in current magnitude reflect altered channel properties rather than expression differences . Wild-type TWK-18 should always be characterized in parallel as a direct comparison control under identical experimental conditions, particularly important given TWK-18's temperature sensitivity . Proper membrane targeting should be confirmed through techniques such as immunofluorescence or by using epitope-tagged constructs. Electrophysiological characterization should include measurements of multiple channel parameters (current-voltage relationships, ion selectivity, single-channel conductance, open probability, and temperature sensitivity) to comprehensively profile the mutant's functional alterations . Channel behavior should be tested across a range of physiologically relevant temperatures rather than at a single temperature point . Finally, in vivo validation through transgenic expression in C. elegans can confirm whether the electrophysiological changes observed in heterologous systems translate to altered physiology and behavior in the organism, providing crucial context for interpreting the mutation's significance.

What statistical approaches are most appropriate for analyzing temperature-dependent effects on TWK-18 currents?

Analyzing temperature-dependent effects on TWK-18 currents requires statistical approaches that can account for the non-linear nature of temperature responses and potential confounding variables . Arrhenius analysis provides a robust framework, plotting the natural logarithm of current magnitude or kinetic parameters against the inverse of absolute temperature (1/T in Kelvin) to determine activation energies and identify transition temperatures where mechanisms might change. Q₁₀ analysis, calculating the current ratio for a 10°C temperature change, offers a standardized measure of temperature sensitivity that can be compared across different channels and conditions. Multiple linear regression models incorporating temperature as a continuous variable along with other factors (voltage, ion concentrations) can identify significant interactions. For single-channel analyses, temperature effects on conductance and open probability should be separated using appropriate statistical models, as these parameters may have different temperature dependencies. Mixed-effects models are valuable when analyzing data from multiple cells or patches, accounting for between-cell variability while extracting population-level temperature effects. Non-parametric approaches may be necessary if the data violate normality assumptions, particularly at temperature extremes where channel behavior might change dramatically. Regardless of the specific approach, statistical analyses should include appropriate corrections for multiple comparisons when examining effects across different voltages or temperatures to maintain statistical rigor.

How can contradictory findings in TWK-18 research be reconciled through experimental design?

Contradictory findings in TWK-18 research can often be reconciled through careful experimental design that addresses potential sources of discrepancy . Researchers should first standardize experimental conditions, particularly temperature control protocols, as even small variations in recording temperature can significantly affect TWK-18 currents given its high temperature sensitivity . The expression system used (oocytes versus mammalian cells) can strongly influence channel behavior, necessitating direct comparisons in identical systems when contradictory results emerge. Different recording configurations (whole-cell versus excised patch) might reveal different aspects of channel regulation, requiring integration of findings across techniques rather than viewing them as contradictory. Channel modulation by intracellular factors could explain discrepancies between intact cell and cell-free recordings, suggesting experiments with controlled intracellular solution manipulation. RNA editing, alternative splicing, or post-translational modifications might create functional channel variants with different properties, warranting sequencing validation and protein analysis. Contradictory temperature effects specifically might reflect different temperature ranges examined or different rates of temperature change, requiring standardized temperature protocols. Meta-analysis approaches combining data across multiple studies with appropriate statistical corrections for between-study variability can help identify consistent effects amid apparent contradictions. Finally, computational modeling integrating diverse experimental datasets can sometimes reconcile seemingly contradictory findings by identifying parameter spaces where all observations are compatible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.