Recombinant TWiK family of potassium channels protein 7 (twk-7)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

TWK-7 is encoded by the KCNK7 gene in humans and twk-7 in Caenorhabditis elegans. While human KCNK7 remains non-functional in heterologous systems without auxiliary partners , C. elegans TWK-7 has demonstrated physiological roles in neuronal and muscular activity . Recombinant TWK-7 is produced in E. coli systems fused with a hexahistidine (His) tag for purification .

Key Properties of Recombinant TWK-7:

PropertyDetails
Source OrganismCaenorhabditis elegans
Expression HostEscherichia coli
Amino Acid Sequence557 residues (UniProt ID: P34410), including two pore domains (P1/P2)
Purity>90% (SDS-PAGE verified)
ApplicationsStructural studies, ion channel activity assays

Role in C. elegans Locomotion

TWK-7 deficiency in C. elegans motor neurons results in:

  • Hyperactive locomotion: Null mutants (twk-7(nf120)) exhibit 50% faster crawling (0.48 Hz vs. 0.16 Hz in wild-type) and 28% faster swimming (2.16 Hz vs. 1.68 Hz) .

  • Persistent forward movement: Loss of TWK-7 disrupts GABAergic inhibition, leading to unmodulated motor neuron activity .

Interaction With Signaling Pathways

  • Gαs-PKA pathway: TWK-7 activity opposes PKA-mediated excitation, acting as a brake on motor neuron output .

  • Mechanosensitivity: TWK-7 may regulate stretch-activated currents in muscle cells, akin to mammalian TREK-1 channels .

Comparative Analysis of K2P Channels

ChannelGenePore MotifFunctional Characteristics
TWIK-1KCNK1GLGpH-sensitive, weak inward rectifier
TASK-1KCNK3GFGExtracellular acid-sensing, leak current
TWK-7KCNK7GLENon-functional alone; requires partners

Research Challenges and Opportunities

  • Functional reconstitution: Human KCNK7 requires unidentified subunits for plasma membrane trafficking .

  • Therapeutic potential: C. elegans TWK-7 models may elucidate mechanisms for treating hyperexcitability disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid protein exhibits a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
twk-7; twk-8; F22B7.7; TWiK family of potassium channels protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-557
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
twk-7
Target Protein Sequence
MTSSSRGYQRVDSSGDGGSLLMEEEGDNPHEALLHRNNDDYASTYHHVGVEYDSYEELER HEMDDRVTEIPEGFHRRQRRNLIYGDDVATDEELRVLRREALFGEEVTRAGLGRAEYYED SHLIHSCDKSGHEDIDDESDDESKDEDEEEEETGIRKFAKLVLPHVALVLLTCTYTVIGA LIFYSVEQPHEQMMKEQQLKLIYTRQNEFVDDLIRLAAGNETKRYEWESLAERHMHNMSD QLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWCILF SLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHGMGH DMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLMPRR DGYMYIILLYIILGLAITTMCIDLVGVQYIRKIHYFGRKIQDARSALAVVGGKVVLVSEL YANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRYIDQTADAATISTSSSAIDM QSCRFCHSRYSLNRAFK
Uniprot No.

Target Background

Gene References Into Functions
  1. Our research identified TWK-7 as a potential downstream target of the GalphaS-KIN-1/PKA pathway in gamma-aminobutyric acid (GABA)ergic D-type motor neurons. This epistatic interaction suggests that KIN-1/PKA and TWK-7 may share a common pathway involved in modulating locomotor activity and locomotion behavior during forward crawling. PMID: 28341653
  2. Our findings suggest that TWK-7 activity may serve as a mechanism for regulating complex locomotion behavior at the level of specific motor neuron types. PMID: 27535928
Database Links

KEGG: cel:CELE_F22B7.7

STRING: 6239.F22B7.7

UniGene: Cel.17711

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genetic and molecular classification of TWiK-7?

TWiK-7 (KCNK7) belongs to the two-pore-domain potassium channel (K2P) family, with the gene located on chromosome 11q13 . K2P channels typically produce quasi-instantaneous and noninactivating currents that remain active across all membrane potentials . The following table summarizes KCNK7 in relation to other members of the K2P family:

ChannelGeneChromosomal Location
TWIK-1KCNK11q41-42
TREK-1KCNK21q41
TASK-1KCNK32p23
TRAAKKCNK411q13
TASK-2KCNK56p21
TWIK-2KCNK619q13
KCNK7KCNK711q13

Why is TWiK-7 classified as a "silent" channel?

KCNK7 is considered "silent" because it fails to produce measurable currents in heterologous expression systems . This characteristic is shared with three other K2P channels: TWIK1 (KCNK1), THIK2 (KCNK12), and TASK5 (KCNK15) . The silence appears related to intracellular retention, with KCNK7 primarily localized to the endoplasmic reticulum rather than trafficking to the plasma membrane . This cellular distribution pattern makes functional studies particularly challenging, requiring specialized experimental approaches beyond standard electrophysiological techniques.

What are the unique structural features of TWiK-7 compared to other K2P channels?

TWiK-7 contains a highly unusual sequence in its second pore domain that distinguishes it from all other potassium channels . While most potassium channels contain a signature GYG sequence in their pore domain (which in K2P channels is typically replaced by GFG or GLG), KCNK7 uniquely contains a GLE motif . This substitution of a glutamic acid residue (E) for the strictly conserved glycine (G) is unprecedented among potassium channels and likely impacts its ionic selectivity and functionality . This structural anomaly may contribute to its classification as a silent channel and represents a critical consideration when designing mutagenesis experiments.

What experimental design considerations are crucial when studying TWiK-7 expression patterns?

When designing TWiK-7 expression experiments, researchers should implement several methodological controls:

First, robust randomization is essential, as approximately 95% of genetic studies show major experimental design problems, particularly regarding randomization relative to phenotypes of interest . This can lead to spurious associations and experimental artifacts, especially problematic when combining multiple experiments .

Second, subcellular fractionation and co-localization studies are critical since KCNK7 primarily localizes to the endoplasmic reticulum . Consider co-expressing KCNK7 with intracellular marker proteins like Rab7-GFP to accurately determine subcellular distribution .

Third, expression should be assessed across multiple time points, as some related channels like rat TWIK2 have shown time-dependent translocation patterns from intracellular compartments to the plasma membrane after extended expression periods, though this wasn't confirmed in all cell types .

Fourth, tissue selection should be strategic, focusing particularly on peripheral blood leukocytes where KCNK7 shows highest expression levels .

How can researchers overcome the experimental challenges of studying a non-functional channel?

Several methodological approaches can address the challenges of studying functionally silent channels:

Site-directed mutagenesis targeting the unusual GLE motif in the second pore domain represents a primary approach to potentially restore functionality . By systematically converting this sequence to the more canonical GLG or GFG found in other K2P channels, researchers can determine if this unusual sequence is responsible for the channel's silence .

Consider developing chimeric channel constructs combining functional domains from active K2P channels with domains from KCNK7. This approach has proven valuable in understanding other silent channels like TWIK1 .

Expression system selection is crucial. While KCNK7 shows no functionality in standard heterologous systems, alternative expression platforms may yield different results . Additionally, co-expression with potential auxiliary subunits might promote functional expression.

For localization studies, high-resolution immunocytochemistry combined with confocal microscopy can precisely map intracellular distribution. This approach has successfully characterized the endoplasmic reticulum localization of KCNK7 and other silent channels .

What experimental design factors are essential when investigating potential physiological roles of TWiK-7?

Investigating physiological roles requires carefully controlled experimental designs:

Implement split-plot experimental designs when dealing with hard-to-change factors in physiological studies . This approach is particularly valuable when certain experimental variables cannot be easily randomized but still need to be assessed for their effects on channel function or expression.

Factorial experimental designs with sufficient statistical power are essential to detect potentially subtle effects . Given the challenges of studying TWiK-7, experiments should be designed to detect small effect sizes, requiring appropriate sample sizes and robust statistical analyses.

Tissue-specific expression analyses should focus on leukocytes, as KCNK7 shows highest expression in peripheral blood leukocytes . This suggests potential immunological functions that warrant targeted investigation in immune cell populations.

How should researchers interpret electrophysiological data when working with TWiK-7?

Interpreting TWiK-7 electrophysiological data requires specialized considerations:

First, establish appropriate baselines using other K2P channels as controls. Under identical conditions, channels like TREK1 (KCNK2) and TASK3 (KCNK9) typically produce more than 5 μA of current, while TWIK2 produces less than 1 μA . This comparative approach helps contextualize the apparent silence of KCNK7.

Second, investigate pH sensitivity, as related channels (TWIK-1 and TWIK-2) are inhibited by intracellular acidity . This environmental factor could potentially modulate any residual KCNK7 activity.

Third, carefully evaluate the experimental time course. Some K2P channels show time-dependent translocation to the plasma membrane, though this varies by expression system and cell type . Extended recording periods and expression timelines may reveal activity not detected in acute experiments.

Fourth, consider non-standard recording conditions. The unusual pore sequence of KCNK7 suggests potential alterations in ion selectivity that might only be detected under specific ionic conditions or with alternative permeant ions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.