Recombinant TWiK family of potassium channels protein 9 (twk-9)

Shipped with Ice Packs
In Stock

Description

Ion Channel Activity

  • Ion Selectivity: TWiK channels typically conduct K⁺ ions under physiological conditions, but may exhibit altered selectivity under specific stimuli (e.g., pH changes) .

  • pH Sensitivity: Human KCNK9 (TASK3) is inhibited by extracellular acidification and activated by alkalization , though similar data for C. elegans twk-9 are not explicitly reported in the provided sources.

Heterodimerization and Channel Assembly

  • TWiK channels can form heterodimers with other subunits (e.g., TASK-1/KCNK3), altering gating kinetics and sensitivity to modulators . For example, heterodimers of human TASK-1/TASK-3 exhibit intermediate pH sensitivity and distinct anesthetic responses . While direct evidence for twk-9 heterodimers is lacking, its structural similarity suggests potential interactions with other C. elegans TWiK subunits.

Physiological Roles

  • Neuronal Regulation: In humans, KCNK9 regulates neuronal excitability and action potential repolarization . C. elegans twk-9 may contribute to analogous processes, though specific roles in development or behavior remain uncharacterized.

  • Ray Development: twk-9 is implicated in regulatory networks controlling ray development and function in C. elegans .

Research Applications

The recombinant twk-9 protein is utilized in diverse experimental contexts:

ApplicationDescription
ElectrophysiologyStudying ion flux, gating kinetics, and pH-dependent channel activity in vitro .
Structural AnalysisInvestigating pore domain architecture and subunit interactions via cryo-EM or X-ray crystallography .
Drug ScreeningTesting modulators of TWiK channels (e.g., arachidonic acid, anesthetics) .
Disease ModelingExploring TWiK channel dysfunction in neurodegenerative or metabolic disorders .

Comparative Analysis with Human KCNK9 (TASK3)

While C. elegans twk-9 and human KCNK9 share structural homology, key differences exist:

FeatureC. elegans twk-9Human KCNK9 (TASK3)
UniProt IDQ23435Q9NPC2
Ion SelectivityLimited dataK⁺-selective; Na⁺ permeability under acidosis
pH SensitivityNot explicitly characterizedpK ~6.8 (inhibition by acidification)
Tissue ExpressionRay development network Brain, adrenal gland, retina
Regulatory MechanismsUnknownGPCR-mediated inhibition, anesthetic activation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we can accommodate specific format requirements. Please indicate your preference in order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While the tag type is determined during production, we can accommodate specific tag requirements. Please inform us of your desired tag, and we will prioritize its development.
Synonyms
twk-9; ZK1251.8; TWiK family of potassium channels protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-568
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
twk-9
Target Protein Sequence
MKCSFHIPEKYQWASTLFVHVALIAGVAVYTVFGALSMQWLESPDRVRALLKRELKPVES LPPPPSISGLPDRITRVYLGEELAILDPGVHECLERTILTLFHDTKCDPYSFEHLNIELI DRCYAEANVPIPEGYGGQPRKKIKNKEEEKDVIDETPAEKWSIGNSVIFAFTVITTIGYG HVAPETFEGRLFLIFYGVIGVPFTLLTIADLGMFLTRFLKNLLTMARRFAHYLVKLYQKA KKQRNKSQKTSPVMPDSERSEVWNTGKEMKEMSMRTAREPGEGDEIEVIENGNDENGKEE DEEEPENNEPRKTEESIALGITFTCYLVAGAKILSVYEPEMDFFKALYFNFVTLTTIGLG DFVPKSFDYLLITLIYIGIGLALTTMAIEIAADLLKKLHYIGRKMENVGQAVVWFGGKKM TMKSLVKHLGDQFNIPEEELANFDMSAFVDNAIKVEKGEIATLRKPPTPPVVFRERAFSF SNVRNSSESALKYVDDNRFSKTTQPTIYTVIIHETTRTIDTLHNLADAIRRDPSIPRLDL DVHYLTDMSAPTSFDENYLRTYTNARRK
Uniprot No.

Target Background

Function
This potassium channel protein is potentially involved in the regulatory network controlling ray development and function.
Database Links

KEGG: cel:CELE_ZK1251.8

STRING: 6239.ZK1251.8

UniGene: Cel.12254

Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in ray A-type neurons and cell bodies. Also seen in head, pharyngeal and phasmid neurons, and in coelomocytes.

Q&A

What is the TWiK family of potassium channels and how is TWiK-9 classified within this family?

The TWiK (Two-pore domain Weak Inward rectifying K+ channel) family belongs to the larger group of two-pore domain potassium (K2P) channels. These channels are characterized by having two pore-forming domains in tandem and four transmembrane segments. TWiK-9 is classified based on sequence homology and structural characteristics with other members of this family. The TWiK family is expressed in various tissues including the vascular system, and members like TWIK-2 have been extensively studied as models for understanding the broader family's functions . Research approaches for TWiK-9 would follow similar patterns to those established for characterizing other family members, beginning with genetic sequencing and progressing to functional analysis.

How do experimental approaches differ between studying TWiK-9 and other potassium channels?

TWiK family channels present unique experimental challenges compared to other potassium channel types. Studies of TWIK-2 have shown that these channels often exhibit relatively linear current-voltage relationships at physiological K+ concentrations, distinguishing them from classical inwardly rectifying K+ channels . When designing experiments for TWiK-9, researchers must account for these specific electrophysiological properties. Additionally, the lack of specific inhibitors or activators for TWiK family members necessitates creative approaches to channel characterization, often requiring combinations of molecular biology techniques with electrophysiology. Expression systems must be carefully selected to ensure proper trafficking to the plasma membrane, as demonstrated in TWIK-2 studies where GFP tagging was necessary to confirm surface expression .

What cloning strategies are most effective for isolating TWiK-9 from tissue samples?

Based on successful approaches with other TWiK family members, the recommended cloning strategy involves:

  • Tissue selection based on expression profiling data (vascular tissues are often used for TWiK family members)

  • RNA extraction and reverse transcription to obtain cDNA

  • PCR amplification using high-fidelity polymerase (such as Pfu DNA polymerase) with primers spanning the complete coding region

  • Gel purification of the amplified product

  • Addition of 3'-A overhangs for TA cloning

  • Ligation into an appropriate vector system (pGEM-T Easy Vector works well for initial cloning)

  • Sequence validation before subcloning into expression vectors

This approach, which was successful for TWIK-2 cloning from rat middle cerebral artery, provides a methodological framework applicable to TWiK-9 isolation .

What expression systems are optimal for functional characterization of recombinant TWiK-9?

When selecting an expression system for TWiK-9 functional studies, researchers should consider:

  • Cell line stability and endogenous channel expression (CHO-K1 cells have been successfully used for other TWiK family members)

  • Transfection efficiency (lipid-based methods like Lipofectamine 2000 work well for these channels)

  • Protein tagging strategy (N-terminal GFP tagging has proven effective for visualizing membrane expression)

  • Selection method for establishing stable cell lines (neomycin resistance has been successfully employed)

  • Quality control measures to confirm surface expression (biotinylation of surface proteins followed by Western blot analysis)

This systematic approach ensures proper channel expression and trafficking to the plasma membrane, which is critical for subsequent functional studies.

How should electrophysiological protocols be optimized for TWiK-9 characterization?

Electrophysiological characterization of TWiK-9 should employ:

  • Whole-cell patch-clamp recordings using appropriate amplifiers (e.g., Axopatch 200B)

  • Data acquisition software capable of complex voltage protocols (e.g., pCLAMP)

  • Careful correction for liquid junction potentials

  • Step protocols to assess voltage-dependent properties

  • Ramp protocols to evaluate rectification characteristics

  • Pharmacological testing with known modulators of K2P channels

  • Ion substitution experiments to determine selectivity

It's important to note that, based on studies of related channels, filtering at 2 kHz with a four-pole Bessel filter is appropriate, and researchers should consider whether compensation for cell capacitance or series resistance is necessary based on the specific experimental questions .

What experimental designs are most appropriate for studying TWiK-9 regulation in physiological contexts?

When investigating TWiK-9 regulation, researchers should consider:

  • Randomized experimental designs with appropriate controls to establish causal relationships between regulatory factors and channel function

  • Repeated-measurement designs to assess acute versus chronic effects of regulatory molecules

  • Field or natural experiments to understand channel behavior in native tissues under physiological conditions

  • Quasi-experimental approaches when complete randomization is not feasible

For cellular regulation studies, designs should incorporate:

  • Site-directed mutagenesis to identify key regulatory residues

  • Biochemical assays to detect post-translational modifications

  • Interaction studies to identify regulatory protein partners

  • Live-cell imaging to track channel trafficking

  • Pharmacological interventions to probe regulatory pathways

These approaches allow for comprehensive characterization of the complex regulatory mechanisms controlling TWiK-9 function in various physiological states.

How should researchers address data volume challenges in TWiK-9 electrophysiological recordings?

Electrophysiological studies of ion channels like TWiK-9 generate substantial data volumes that require systematic analysis approaches. Researchers should:

The balance between comprehensive data collection and focused analysis is particularly important for TWiK channel research, where subtle biophysical properties may have significant physiological implications.

What statistical approaches are most appropriate for analyzing TWiK-9 pharmacological response data?

When analyzing pharmacological responses of TWiK-9:

  • Employ dose-response modeling with appropriate curve fitting (typically using Hill equation parameters)

  • Conduct paired statistical tests when comparing before/after drug application in the same cells

  • Use ANOVA with post-hoc tests for multi-condition comparisons

  • Consider time-dependent effects requiring time-series analysis

  • Account for potential cell-to-cell variability using hierarchical statistical models

Researchers should distinguish between time-sensitive analyses (such as acute drug effects) and retrospective analyses (such as comparing expression levels across conditions), applying the appropriate analytical paradigm in each case .

What are common challenges in achieving functional expression of recombinant TWiK-9 and how can they be overcome?

Based on experiences with other TWiK family members, common expression challenges include:

  • Poor membrane trafficking - Solution: Optimize signal sequences or use chimeric approaches with well-expressed channels

  • Protein misfolding - Solution: Adjust incubation temperature (30-33°C often improves folding of challenging membrane proteins)

  • Low expression levels - Solution: Codon optimization for the expression system and use of high-expression vectors

  • Cytotoxicity - Solution: Use inducible expression systems to control expression timing and level

  • Validation difficulties - Solution: Implement multiple validation methods including Western blotting of biotinylated surface proteins , electrophysiology, and fluorescence microscopy with GFP-tagged constructs

Each TWiK family member may present unique challenges, requiring systematic optimization of expression conditions.

How can researchers distinguish between direct effects on TWiK-9 and indirect effects mediated through regulatory pathways?

To differentiate direct and indirect effects on TWiK-9 function:

  • Employ excised patch recordings (inside-out or outside-out configurations) to isolate the channel from intracellular signaling cascades

  • Use purified proteins in reconstituted systems (liposomes or planar lipid bilayers) for direct interaction studies

  • Compare results from heterologous expression systems with different signaling backgrounds

  • Conduct parallel experiments with signaling pathway inhibitors to block indirect effects

  • Perform site-directed mutagenesis of potential regulatory sites to prevent specific modifications

These experimental strategies, combined with careful controls, help establish causal relationships between observed effects and their molecular mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.