Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (pulO)

Shipped with Ice Packs
In Stock

Description

Introduction to PulO

Type 4 prepilin-like proteins leader peptide-processing enzyme (PulO) is encoded by the pulO gene, which is the final gene in the pulC-O pullulanase secretion gene operon of Klebsiella oxytoca and Klebsiella pneumoniae . This enzyme performs two critical functions: it cleaves type-4 fimbrial leader sequences and methylates the N-terminal residue (generally phenylalanine) of the processed protein . These enzymatic activities are essential for the proper maturation of type IV pilin-like proteins and the subsequent assembly of the secretion machinery required for pullulanase translocation .

PulO belongs to the peptidase A24 family, a group of enzymes specialized in processing type IV prepilin and prepilin-like proteins . Its significance extends beyond pullulanase secretion, as it represents a model system for understanding similar secretion pathways in other bacteria, including those relevant to pathogenesis and environmental interactions.

Dual Enzymatic Activities

PulO functions as a bifunctional enzyme with both peptidase and methyltransferase activities . Its peptidase activity specifically targets the conserved cleavage site in type IV prepilin and prepilin-like proteins, cleaving after the glycine residue in the sequence GF(M)XXXE (where X represents hydrophobic amino acids) . Following cleavage, the methyltransferase activity of PulO modifies the newly exposed N-terminal residue, typically phenylalanine, through N-methylation .

This dual enzymatic capability distinguishes PulO from single-function enzymes and highlights its specialized role in bacterial secretion systems. The precise coordination of these activities ensures proper substrate processing and subsequent functional assembly of secretion components.

Processing Kinetics and Substrate Recognition

The substrate specificity of PulO extends to multiple proteins within the pullulanase secretion system. Four gene products in the pulC-O operon (PulG, PulH, PulI, and PulJ proteins) contain the prepilin peptidase cleavage site recognized by PulO . Experimental evidence confirms that PulO effectively processes the PulG gene product in vivo, and similar processing likely occurs for the other prepilin-like proteins in the operon .

The Pullulanase Secretion System

PulO plays a critical role in the pullulanase secretion pathway of Klebsiella species. Pullulanase (PulA) is an extracellular enzyme that hydrolyzes pullulan, a polysaccharide polymer . The secretion of this enzyme requires a complex machinery encoded by the pulC-O operon, with PulO being essential for the maturation of several components of this machinery .

The pullulanase secretion system represents a specialized type II secretion system, which requires the assembly of a multiprotein complex spanning the bacterial cell envelope. PulO's processing activity is crucial for the proper assembly and function of this complex.

Processing of Secretion Components

PulO processes multiple components of the pullulanase secretion machinery, including PulG, PulH, PulI, and PulJ . These proteins share structural similarities with type IV pilins and require leader peptide cleavage for maturation. Experiments have shown that PulO can process the native PulG protein as well as PulG derivatives with internal inframe deletions .

Interestingly, not all fusion proteins are processed by PulO. Studies have demonstrated that PulG-PhoA hybrids, PulJ-PhoA hybrids, and PulH-PhoA hybrids do not appear to be processed by PulO, suggesting specific structural requirements for substrate recognition .

Cellular Localization and Assembly

Subcellular fractionation experiments have provided insights into the localization of PulO and its substrates. Both the precursor and mature forms of PulG, a key substrate of PulO, have been found associated with low-density, outer membrane vesicles prepared by osmotic lysis of spheroplasts . This localization pattern is consistent with the role of these proteins in forming the secretion apparatus that spans the bacterial cell envelope.

The processed components subsequently assemble into a functional secretion machine capable of translocating pullulanase across the outer membrane. The absence of PulO leads to a complete defect in pullulanase secretion, highlighting its essential role in this process .

Evolutionary Relationships

PulO shares significant sequence homology with other type IV prepilin peptidases, reflecting evolutionary conservation of this important enzymatic function across different bacterial species. The protein encoded by the pulO gene is 52% identical to the product of the pilD/xcpA gene from Pseudomonas aeruginosa, which is required for extracellular protein secretion and type IV pilus biogenesis .

Similar homologies exist with other prepilin peptidases, such as TcpJ from Vibrio cholerae and ComC from Bacillus subtilis . These relationships highlight the widespread occurrence and importance of prepilin peptidases in diverse bacterial species.

Comparative Functionality

Despite significant sequence homology between different prepilin peptidases, there appears to be functional specificity in their substrate recognition and processing capabilities, as summarized in the following table:

Prepilin PeptidaseOrganismHomology to PulOCan Process PulG?Can Restore Pullulanase Secretion?
PulOKlebsiella oxytoca/pneumoniae100%YesYes
XcpA (PilD)Pseudomonas aeruginosa52%NoNo
ComCBacillus subtilisHomologous (% not specified)NoNo
PilDNgNeisseria gonorrhoeaeHomologous (% not specified)YesPartially

Experimental evidence demonstrates that neither the xcpA gene nor the B. subtilis comC gene can correct the pullulanase secretion defect in an Escherichia coli strain carrying all genes required for secretion except pulO . Furthermore, neither XcpA nor ComC is able to process prePulG protein in vivo, despite their sequence similarities to PulO .

Cross-Species Activity

Interestingly, while some prepilin peptidases cannot substitute for PulO in processing its native substrates, there are cases of cross-species functionality. The N. gonorrhoeae prepilin peptidase gene, pilDNg, can partially complement a mutation in pulO, partially restoring PulG-PulO-dependent extracellular secretion of pullulanase .

Conversely, PulO has been shown to correctly process the product of the cloned pilE.1 type IV pilin structural gene from N. gonorrhoeae when expressed in E. coli . This cross-species activity demonstrates the potential for functional overlap between prepilin peptidases from different bacteria, despite their substrate specificities.

Expression and Purification

Recombinant PulO is typically produced as a His-tagged protein in E. coli expression systems . The full-length protein (amino acids 1-228) is expressed with an N-terminal His-tag to facilitate purification using affinity chromatography . The recombinant protein retains its enzymatic activities when properly folded and purified.

The properties and handling recommendations for recombinant PulO are summarized in the following table:

PropertyDescription
Expression SystemE. coli
TagN-terminal His-tag
FormLyophilized powder
Purity>90% (determined by SDS-PAGE)
Storage-20°C/-80°C, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol
ApplicationsSDS-PAGE, enzymatic assays

Stability and Activity Considerations

Recombinant PulO, like many enzymes, is sensitive to repeated freeze-thaw cycles . For optimal activity, it is recommended to store working aliquots at 4°C for up to one week and to maintain long-term storage at -20°C or -80°C . The addition of glycerol (typically 5-50% final concentration) to reconstituted protein helps maintain stability during storage .

The enzymatic activity of recombinant PulO can be assessed through its ability to process type IV prepilin substrates. The processing can be monitored by analyzing the size shift of the substrate protein using SDS-PAGE or through specific activity assays measuring the peptidase or methyltransferase functions .

Fundamental Research

PulO has been extensively used as a model system for studying type IV prepilin processing and secretion pathways. Its dual enzymatic activities and essential role in pullulanase secretion make it valuable for understanding similar systems in other bacteria, including pathogens that utilize type IV pili for virulence .

Research on PulO has contributed to our understanding of bacterial secretion mechanisms, protein processing, and the assembly of multiprotein complexes. The insights gained from studying PulO have broader implications for bacterial physiology, pathogenesis, and the evolution of specialized secretion systems.

Biotechnological Applications

The pullulanase secretion system, including PulO, has potential biotechnological applications. Research has explored the possibility of using the K. oxytoca secreted pullulanase (PulA) as a determinant for the secretion of heterologous proteins as fusion proteins .

Fusion proteins created between PulA and various cellulolytic enzymes from Cellulomonas fimi (CenA, CenB, and Cex) have been shown to retain cellulolytic activity when expressed in E. coli cells . This suggests that the pullulanase secretion pathway, dependent on PulO processing, could potentially be engineered for the extracellular production of industrially relevant enzymes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pulO; Prepilin leader peptidase/N-methyltransferase; Pullulanase secretion protein PulO [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Names
pulO
Target Protein Sequence
MVENIALLPEFAAQYPFLWGSFLFLSGLAFGSFFNVVIHRLPLMMEQAEGINLCFPASFC PQCREPIAWRDNIPLLGFLFLKGRSRCCGQPISPRYPLMELATGALFVLAGYLMAPGVPL LGGLILLSLLLILAAIDAQTQLLPDGLTLPLMWAGLLFNLSATYVPLAEAVVGAMAGYLS LWSVYWVFRLLSGKEALGYGDFKLLAALGAWLGWQALPQTLLLASPAA
Uniprot No.

Target Background

Function
PulO plays a crucial role in the formation of type IV pili and type II pseudopili. It functions by proteolytically removing the leader sequence from substrate proteins and subsequently monomethylating the α-amino group of the newly exposed N-terminal phenylalanine.
Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of PulO in bacterial systems?

PulO functions as a prepilin peptidase responsible for the processing of prepilin proteins in the pullulanase secretion pathway of Klebsiella oxytoca. Methodologically, researchers have confirmed this role through complementation studies where PulO successfully processes the product of the cloned pilE.1 type IV pilin structural gene from Neisseria gonorrhoeae when expressed in Escherichia coli . The enzyme specifically cleaves the N-terminal signal peptide of prepilins, a critical step for the maturation of pilins that will eventually form type IV pili structures on the bacterial surface.

When investigating PulO function, researchers should employ both genetic approaches (complementation studies, gene knockout) and biochemical assays (substrate processing analysis) to comprehensively characterize its activity in native and heterologous systems. Subcellular fractionation techniques reveal that both processed and unprocessed pilin proteins remain associated with the cytoplasmic membrane, indicating PulO's involvement in membrane-associated processing events .

How is PulO structurally and functionally related to other prepilin peptidases?

PulO shows high sequence homology to several type IV prepilin peptidases, particularly XcpA(PilD) from Pseudomonas aeruginosa and TcpJ from Vibrio cholerae . This homology extends to functional similarities, as demonstrated in cross-complementation studies where the P. aeruginosa prepilin peptidase and ComC from Bacillus subtilis can also process the same prepilin substrate (prePilE) .

For researchers investigating these relationships, comparative genomic approaches combined with functional assays are recommended. Southern hybridization experiments have suggested the presence of a pulO homologue in the N. gonorrhoeae chromosome . When designing experiments to explore functional conservation, consider testing:

  • Cross-species substrate processing

  • Domain swapping between homologous peptidases

  • Site-directed mutagenesis of conserved residues

  • Phylogenetic analysis of peptidase distribution across bacterial species

What techniques are most effective for studying PulO processing activity?

Investigating PulO activity requires a combination of genetic, biochemical, and imaging techniques. Based on established methodologies, researchers should consider:

Genetic Fusion Approach: Creating prepilin-reporter protein fusions (such as prePilE-PhoA) can reveal processing efficiency and substrate specificity. PulO has been shown to process three of four prePilE-PhoA hybrids tested, indicating some structural constraints on substrate recognition .

Immunoblotting Analysis: This technique effectively detects and quantifies both precursor and processed forms of PulO substrates. Researchers should use appropriate antibodies that can distinguish between glycosylated and non-glycosylated forms, as demonstrated in studies of PilA1 processing .

Metabolic Labeling: Pulse-chase experiments with radiolabeled amino acids (e.g., [35S]-Met/Cys) allow for tracking the synthesis and processing kinetics of prepilins. This approach has been successfully used to compare prepilin synthesis rates between wild-type and mutant strains .

Co-immunoprecipitation: To study interactions between prepilins and other cellular components (such as SecY translocons), co-immunoprecipitation provides valuable insights. This method revealed that native pPilA co-immunoprecipitated with SecY, indicating an interaction between prepilins and the translocon .

How can researchers generate and characterize prepilin peptidase mutants?

The generation and characterization of prepilin peptidase mutants is critical for understanding their function. A methodological approach should include:

Gene Knockout Strategy: Complete deletion of prepilin peptidase genes (e.g., pilD) can reveal their essentiality and phenotypic consequences. For instance, a ΔpilD mutant in Synechocystis sp. PCC 6803 shows impaired photoautotrophic growth due to disrupted Sec translocon function .

Suppressor Mutation Analysis: When direct knockout produces severe phenotypes, isolating suppressor strains can provide insights into functional mechanisms. Researchers have identified secondary mutations that suppress the growth defect in ΔpilD mutants, including mutations in:

  • SigF sigma factor

  • γ subunit of RNA polymerase

  • Signal peptide of major pilin PilA1 (S3G mutation)

  • pilA1-pilA2 intergenic region

Functional Complementation: Testing the ability of homologous peptidases from other species to restore function in mutants provides insights into conserved mechanisms. This approach demonstrated that various prepilin peptidases (PulO, XcpA(PilD), ComC) can process the same substrate despite evolutionary divergence .

How does glycosylation affect prepilin processing and cellular impacts?

Glycosylation of prepilins appears to play a significant role in their cellular effects. Researchers investigating this phenomenon should employ the following methodological approaches:

Glycosylation Analysis: Using differential migration patterns on SDS-PAGE combined with specific glycoprotein staining techniques can distinguish between glycosylated and non-glycosylated forms of prepilins. In the Synechocystis ΔpilD strain, approximately 50% of accumulated prepilin was non-glycosylated pPilA1 (pPilA1*) and 50% was glycosylated pPilA1 (pPilA1g*) .

Membrane Localization Studies: Techniques like fluorescence microscopy with labeled prepilins or membrane fractionation can reveal the distribution of differently glycosylated forms. Evidence suggests that non-glycosylated PilA1 prepilin has restricted lateral mobility, leading to accumulation in translocon-rich membrane domains .

Translocon Function Assays: Measure the impact of prepilin accumulation on translocon function using reporter substrates or assessing the synthesis of essential membrane proteins. The proposed mechanism suggests that non-glycosylated prepilin accumulation specifically attenuates membrane protein synthesis .

Prepilin FormGlycosylation StatusMembrane MobilityEffect on Translocons
pPilA1*Non-glycosylatedRestrictedInhibitory
pPilA1g*GlycosylatedHigherLess inhibitory
Mature PilA1GlycosylatedNormalNo inhibition

What mechanisms underlie the synthetic lethality between prepilin peptidase deficiency and cellular growth?

The observation that ΔpilD mutants in Synechocystis cannot grow photoautotrophically points to essential connections between prepilin processing and vital cellular functions. Research approaches should include:

Physiological Characterization: Compare growth under different conditions (heterotrophic vs. photoautotrophic) and measure photosynthetic parameters to identify specific processes affected by prepilin peptidase deficiency .

Suppressor Mutation Analysis: The isolation and characterization of suppressor mutations provides mechanistic insights. For example, the S3G mutation in the signal peptide of PilA1 reduced the inhibitory effect on translocons, suggesting that specific properties of the signal peptide influence interaction with the secretion machinery .

Protein Synthesis Rate Analysis: Measure the synthesis rates of key proteins using pulse-labeling techniques. Research has shown that the synthesis of essential membrane proteins is specifically attenuated in prepilin peptidase mutants, while the synthesis of other proteins may continue normally .

Direct Interaction Studies: Use techniques like co-immunoprecipitation to detect physical interactions between unprocessed prepilins and components of essential cellular machinery. The demonstrated interaction between pPilA and SecY translocon components supports a model where accumulated prepilins physically interfere with translocon function .

How should researchers design experimental controls when studying prepilin peptidase function?

Proper experimental controls are essential for accurate interpretation of results in prepilin peptidase studies:

Positive Processing Controls: Include known substrates that are efficiently processed by the peptidase under study. When investigating novel substrates, parallel assays with established substrates provide benchmarks for processing efficiency .

Cross-Species Complementation: Test the activity of homologous peptidases from different species on the same substrate to distinguish general and species-specific aspects of processing. This approach has revealed functional conservation between peptidases like PulO, XcpA(PilD), and ComC .

Glycosylation Controls: Include controls that distinguish between effects of glycosylation and peptidase processing. This can be achieved by using glycosylation inhibitors or glycosylation-deficient strains alongside peptidase mutants .

Growth Condition Variables: Test multiple growth conditions when assessing phenotypic effects. For instance, the increased accumulation of PilA1 in wild-type Synechocystis cells after shifting from glucose-supplemented to glucose-free conditions was only observed after 48 hours of incubation, not after 24 hours .

What analytical approaches best reveal relationships between prepilin processing and cellular physiology?

Advanced analytical methods can uncover subtle connections between prepilin processing and broader cellular functions:

Temporal Analysis: Track changes in prepilin levels and processing over time under different conditions. The finding that PilA1 content increases in wild-type cells after shifting to glucose-free conditions required extended (48-hour) observation periods .

Correlation Analysis: Look for correlations between prepilin processing efficiency and physiological parameters. This approach can reveal threshold effects where cellular functions are maintained until prepilin accumulation reaches critical levels.

Microscopy Combined with Biochemistry: Integrate microscopic visualization of cellular structures with biochemical analysis of protein content and interactions. This combined approach can reveal spatial aspects of prepilin effects that may not be apparent from biochemical data alone.

Multi-Omics Integration: Combine proteomics, transcriptomics, and metabolomics data to build comprehensive models of how prepilin processing affects global cellular function. This approach can identify unexpected pathways affected by prepilin processing defects.

What emerging technologies offer new insights into prepilin peptidase mechanisms?

Several cutting-edge technologies hold promise for advancing understanding of prepilin peptidases:

Cryo-Electron Microscopy: This technique could reveal the structural basis of prepilin-translocon interactions at near-atomic resolution, providing insights into how unprocessed prepilins interfere with translocon function.

Single-Molecule Tracking: These methods can directly visualize the membrane mobility of different prepilin forms, testing the hypothesis that non-glycosylated prepilins have restricted lateral mobility leading to localized accumulation.

Genome-Wide Suppressor Screens: Applying CRISPR-based technologies for comprehensive identification of genetic interactions could reveal unexpected connections between prepilin processing and other cellular pathways.

Synthetic Biology Approaches: Creating minimal systems with defined components could isolate and characterize specific aspects of prepilin peptidase function without the complexity of the entire cellular context.

How do variations in prepilin signal peptides affect processing efficiency and specificity?

Understanding the relationship between signal peptide sequence and processing requires systematic investigation:

Mutational Scanning: Creating libraries of signal peptide variants can identify specific residues critical for recognition and processing. The S3G suppressor mutation in PilA1 demonstrates that even single amino acid changes in the signal peptide can dramatically affect cellular outcomes .

Cross-Species Chimeras: Creating chimeric prepilins with signal peptides from different species can reveal species-specific aspects of recognition and processing. This approach can identify determinants of specificity that may not be obvious from sequence comparison alone.

Quantitative Processing Assays: Developing high-throughput assays for processing efficiency would enable systematic analysis of many signal peptide variants. Such assays should incorporate both in vitro biochemical measurements and in vivo functional readouts.

Computational Prediction: Machine learning approaches trained on experimental data could eventually predict processing efficiency based on signal peptide sequence, potentially guiding the design of peptides with desired processing characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.