Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD)

Shipped with Ice Packs
In Stock

Description

TapD shares conserved aspartate residues (Asp residues) in its active site, a hallmark of TFPPs . These residues are critical for catalytic activity, as demonstrated in homologs like Vibrio cholerae TcpJ and Pseudomonas aeruginosa PilD .

Homolog ComparisonTapD (A. salmonicida)PilD (P. aeruginosa)TcpJ (V. cholerae)
Active Site ResiduesConserved Asp pairs Asp125, Asp189 Asp147, Asp212
Catalytic RoleLeader cleavage/N-methylationLeader cleavage/N-methylationLeader cleavage/N-methylation
Substrate SpecificityType IV prepilins Type IV prepilins Type IV prepilins

Biochemical Role

TapD processes prepilin precursors by:

  1. Cleaving the leader peptide at a conserved cleavage site (e.g., between glycine and phenylalanine in P. aeruginosa prepilin) .

  2. N-methylating the new N-terminal residue to stabilize the mature pilin structure .

Functional Complementation

TapD restores pilus assembly and type II secretion in P. aeruginosa mutants lacking PilD. For example:

  • In vivo assays: TapD-expressing P. aeruginosa PAK 2B18 (pilD−) strains regained hemolysis and pilin polymerization .

  • In vitro cleavage: Membrane fractions containing TapD cleaved P. aeruginosa prepilin into mature pilin, confirming enzymatic activity .

Role in Virulence

TapD is essential for A. salmonicida pathogenesis. Disruption of tapD impairs:

  • Pilus formation: Critical for adherence, motility, and host cell invasion .

  • Toxin secretion: Affects secretion of extracellular enzymes like aerolysin via type II systems .

Comparative Analysis with Other TFPPs

TapD shares functional and structural homology with TFPPs across bacterial genera:

PropertyTapDPilDTcpJ
SpeciesA. salmonicidaP. aeruginosaV. cholerae
Cleavage SiteConserved (e.g., Gly-Phe) Gly-Phe Gly-Phe
N-MethylationYes Yes Yes
Substrate RangeT4P, type II secretion proteins T4P, type II secretion proteins T4P, type II secretion proteins

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
tapD; pilD; Prepilin leader peptidase/N-methyltransferase [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Aeromonas salmonicida
Target Names
tapD
Target Protein Sequence
MTLLLELAHGLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLEREWQAEYRSYFSSDTPQP EDDERYNLMVPRSCCPRCNHPITALENIPLLSWLWLKGRCRGCQAAISARYPLVELLTAL LSVVVAMTLTPGWGTLAALLLTWVLVALTFIDLDKMLLPDQLTLPLLWGGLLFNLLGGYV PLGDAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKLLAALGAWLGWQALPIVLLLSS LVGAIFGIGLILLRNHHQSKPIPFGPYLAIAGWIALLWGDSITRWYLSTIL
Uniprot No.

Target Background

Function
This enzyme plays a critical role in the formation of type IV pili and type II pseudopili. It functions by proteolytically removing the leader sequence from substrate proteins, followed by monomethylation of the alpha-amino group of the newly exposed N-terminal phenylalanine.
Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Type 4 prepilin-like proteins leader peptide-processing enzyme?

Type 4 prepilin peptidases (TFPPs) like TapD are membrane-bound aspartic proteases that catalyze the essential proteolytic processing of pre-pilin and pre-pilin-like proteins. This processing involves cleaving specialized leader peptides from Type 4 prepilins during secretion, which is critical for subsequent pilus assembly. The function is not merely degradative but represents a key post-translational modification necessary for the proper assembly of pili structures and related secretion systems .

Methodologically, the function can be assessed through complementation studies where wild-type processing enzyme is introduced into mutant strains lacking the enzyme, followed by observation of restored pilin processing. This can be detected through techniques such as Western blotting using antibodies against the mature pilin proteins .

How do Type 4 prepilin peptidases differ structurally from other protease families?

Type 4 prepilin peptidases represent a novel family of bilobed aspartate proteases that is structurally distinct from any other known protease. While they share the catalytic mechanism involving aspartic acid residues with other aspartic proteases, TFPPs have a unique architecture:

  • They contain two essential conserved aspartic acid residues located in separate domains of the protein (bilobed structure)

  • They are integral membrane proteins rather than soluble enzymes

  • They typically do not methylate the processed pilin (unlike some other prepilin peptidases)

  • They lack the classic DTG/DSG motifs found in other aspartic proteases

For example, in Vibrio cholerae, the active site pairs of aspartic acids of the TFPPs are found at positions 125 and 189 of TcpJ and 147 and 212 of VcpD, with corresponding aspartate residues completely conserved throughout this extensive peptidase family .

What are the optimal expression conditions for recombinant TapD production?

Optimal expression of recombinant TapD requires careful consideration of several factors:

Expression System Selection:

  • E. coli systems are suitable for initial expression attempts but may require codon optimization

  • Expression in membrane protein-specialized strains like C41(DE3) or C43(DE3) often improves yields for membrane-bound proteases like TapD

Expression Parameters:

  • Temperature: Lower temperatures (16-25°C) typically reduce aggregation and improve folding

  • Induction conditions: Low IPTG concentrations (0.1-0.5 mM) and longer expression times

  • Media supplementation: Addition of membrane-stabilizing agents can improve yields

Solubilization Strategy:

  • Detergent screening is essential (commonly tested: DDM, LDAO, OG)

  • Optimization of detergent concentration and solubilization time

To assess expression efficiency, Western blotting with anti-His antibodies (assuming a His-tag was incorporated) can be used to detect the target protein in membrane fractions followed by activity assays using synthetic peptide substrates designed based on natural prepilin cleavage sites .

How should researchers design experiments to verify TapD substrate specificity?

Designing experiments to determine TapD substrate specificity requires a multi-faceted approach:

Step 1: Candidate Substrate Identification

  • Genomic analysis of organisms containing TapD/TadV homologs to identify potential prepilin-like proteins

  • Bioinformatic screening for proteins containing conserved processing sites (-1/+1 relative to cleavage site)

Step 2: Experimental Validation

  • In vitro processing assays using purified recombinant TapD and synthetic peptide substrates derived from potential prepilin sequences

  • Site-directed mutagenesis of putative cleavage sites followed by processing assays

  • Mass spectrometry to precisely identify cleavage positions

Step 3: Quantitative Analysis

  • Determine kinetic parameters (Km, Vmax, kcat) for different substrates to establish preference

  • Compare wild-type processing to that of mutated substrates with single amino acid changes

Experimental Design Considerations:

  • Include positive controls (known substrates) and negative controls (non-substrate proteins)

  • Implement appropriate blocking conditions to prevent non-specific proteolysis

  • Account for the membrane nature of the enzyme by using detergent-solubilized or reconstituted systems

For example, to determine substrate specificity of TadV in A. actinomycetemcomitans, researchers demonstrated that TadV processes not only the pre-Flp1 prepilin but also the TadE and TadF pilin-like proteins by expressing each substrate with and without TadV in E. coli and analyzing processing via Western blotting .

What control experiments are essential when characterizing novel Type 4 prepilin peptidase mutants?

When characterizing novel Type 4 prepilin peptidase mutants, the following controls are essential:

Enzyme Activity Controls:

  • Positive control: Wild-type enzyme under identical conditions

  • Negative control: Catalytically inactive mutant (e.g., mutation of conserved aspartic acid residues)

  • Vehicle control: Substrate with buffer/detergent conditions but no enzyme

Substrate Processing Controls:

  • Unprocessed substrate: Pre-pilin without exposure to any peptidase

  • Pre-processed substrate: Chemically or enzymatically generated product that mimics the expected cleavage

Expression Controls:

  • Western blots to verify equivalent expression levels between wild-type and mutant proteins

  • Membrane fractionation to confirm proper localization of the mutant enzyme

Functional Outcome Controls:

  • Complementation assays in peptidase-deficient strains to assess functional restoration

  • Phenotypic assays (biofilm formation, pilus assembly, etc.) to correlate processing with function

For example, when studying TadV in A. actinomycetemcomitans, researchers verified that two conserved aspartic acid residues (D40 and D155) were critical for function by generating point mutations and demonstrating loss of processing activity while maintaining proper protein expression levels and localization .

Mutation TypeProcessing ActivityProtein ExpressionMembrane LocalizationPhenotype Rescue
Wild-type100%++++++Yes
D40A<1%++++++No
D155A<1%++++++No
K30A75%++++++Partial
Control vector0%--No

What strategies should be employed for optimizing signal peptide cleavage in recombinant systems?

Optimizing signal peptide cleavage in recombinant systems requires consideration of both the signal peptide itself and its interaction with downstream sequences:

Signal Peptide Selection Strategies:

  • Test multiple signal peptides in parallel rather than assuming one "best" signal peptide

  • Consider a computationally-designed signal peptide like secrecon (MWWRLWWLLLLLLLLWPMVWA) which often shows high efficiency

  • Evaluate signal peptides from similar protein families or the same organism

Optimization of Signal Peptide-Mature Protein Junction:

  • Pay careful attention to residues at the +1/+2 positions (immediately downstream of cleavage site)

  • For efficient processing, prefer small and flexible amino acids at the +1 position (alanine shows good results)

  • Avoid cysteine, proline, tyrosine, and glutamine at the +1 position as they can negatively impact processing efficiency

Experimental Approach:

  • Generate a panel of constructs with different signal peptide/+1/+2 residue combinations

  • Test expression in small-scale cultures

  • Analyze both expression level and processing accuracy using:

    • Western blotting for approximate molecular weight shifts

    • Mass spectrometry for precise cleavage site determination

For recalcitrant proteins, consider adding an alanine at the +1 position regardless of the native sequence, as this has been shown to rescue expression in some cases .

A methodical screening approach is essential as studies have shown that the optimal signal peptide varies significantly depending on the protein of interest. For example, when expressing different antibodies in CHO cells, the expression rates varied dramatically based on signal peptide choice, and no single signal peptide was optimal for all tested antibodies .

How can researchers effectively distinguish between true substrates and non-specific cleavage by recombinant Type 4 prepilin peptidases?

Distinguishing true substrates from non-specific cleavage is a critical challenge in TapD research and requires multiple complementary approaches:

Sequence-Specific Validation:

  • Perform alanine scanning mutagenesis around the putative cleavage site

  • Analyze the effect of mutations on processing efficiency using in vitro assays

  • True substrates typically show conserved residues at positions -1 to -3 relative to the cleavage site

Kinetic Analysis:

  • Compare kinetic parameters (Km, kcat) between putative substrates

  • True substrates typically display significantly higher catalytic efficiency (kcat/Km)

  • Establish threshold values based on known substrates

In Vivo Validation:

  • Generate substrate mutations in the native organism

  • Analyze phenotypic effects (pilus assembly, biofilm formation)

  • Perform co-immunoprecipitation studies to verify enzyme-substrate interactions

Mass Spectrometry Approaches:

  • Perform time-course analysis to identify primary versus secondary cleavage events

  • Utilize stable isotope labeling to track genuine processing events

  • Compare cleavage patterns between wild-type and catalytic mutants of the peptidase

An experimental design that incorporates these methodologies can generate a confidence score for each potential substrate. For example, researchers investigating TadV in A. actinomycetemcomitans first identified TadE and TadF as potential substrates based on sequence similarity to the known Flp1 substrate, then confirmed their status as true substrates by demonstrating processing in both heterologous E. coli systems and the native organism, followed by showing that mutations in the processing sites prevented both cleavage and functional biofilm formation .

What are the current hypotheses regarding the molecular mechanism of Type 4 prepilin peptidase catalysis?

Current hypotheses regarding the molecular mechanism of Type 4 prepilin peptidase catalysis focus on several key aspects:

Aspartic Acid Catalysis Model:
Type 4 prepilin peptidases function as aspartic proteases with two catalytic aspartic acid residues that are essential for activity. In this model:

  • One aspartic acid acts as a general base, activating a water molecule

  • The activated water molecule attacks the scissile peptide bond

  • The second aspartic acid donates a proton to the leaving group

Evidence for this model comes from mutational studies showing that both conserved aspartic acid residues (e.g., D40 and D155 in TadV) are absolutely required for activity .

Substrate Recognition Hypothesis:
Unlike many proteases that recognize specific amino acid sequences, Type 4 prepilin peptidases appear to recognize structural features:

  • The hydrophobic nature of the leader peptide

  • A conserved +1 glutamate/glycine in mature pilins

  • The transition from hydrophobic to charged residues near the cleavage site

Membrane-Associated Processing Model:
The membrane association of these enzymes is proposed to be functionally important:

  • The enzyme's transmembrane domains may position the active site relative to the membrane

  • Substrate leader peptides may interact with the membrane before processing

  • The membrane environment may influence proper enzyme folding and activity

Cooperative Processing Hypothesis:
Some evidence suggests that Type 4 prepilin peptidases may function in complexes:

  • Co-localization with secretion apparatus components

  • Potential for conformational changes during the catalytic cycle

  • Interaction with chaperones that present substrates in the proper orientation

These hypotheses continue to be refined through structural studies, molecular dynamics simulations, and detailed enzyme kinetics. The bilobed nature of these proteases compared to other aspartic proteases suggests a unique evolutionary history and potentially novel catalytic mechanisms that require further investigation .

How do mutations in the catalytic residues of TapD impact bacterial pathogenicity and biofilm formation?

Mutations in the catalytic residues of TapD/TadV have profound impacts on bacterial pathogenicity and biofilm formation, illustrating the critical role of these enzymes in bacterial virulence:

Direct Effects on Pilus Assembly:
Catalytic residue mutations (particularly the conserved aspartic acids) completely abolish prepilin processing, which prevents:

  • Proper pilus assembly

  • Surface attachment

  • Microcolony formation

  • Biofilm maturation

Quantifiable Impacts on Biofilm Formation:
Studies of TadV in A. actinomycetemcomitans demonstrated that D40A and D155A mutations resulted in:

  • 95% reduction in biofilm biomass compared to wild-type

  • Complete loss of the characteristic "star" colony morphology

  • Dramatically reduced autoaggregation in liquid culture

Pathogenicity Connections:
The impacts extend beyond biofilm formation to multiple virulence factors:

  • Reduced colonization ability in animal infection models

  • Impaired horizontal gene transfer via conjugation

  • Decreased resistance to immune clearance mechanisms

  • Attenuated toxin secretion in organisms using type IV secretion systems

Experimental Evidence for Pathogenicity Impact:
In various bacterial pathogens, TapD/TadV catalytic mutants show:

  • Significantly reduced adherence to epithelial cells

  • Decreased persistence in infection models

  • Lower bacterial burdens in target organs

  • Reduced histopathological damage in host tissues

This mechanistic link between TapD catalytic function and bacterial pathogenicity has led to interest in these enzymes as potential targets for novel anti-virulence therapeutics. Since biofilm formation is a major contributor to antibiotic resistance and chronic infections, inhibiting TapD might sensitize bacteria to conventional antibiotics while reducing virulence .

How do Type 4 prepilin peptidases from different bacterial species compare in terms of substrate specificity and catalytic efficiency?

Type 4 prepilin peptidases from different bacterial species show both striking similarities and notable differences in their substrate specificity and catalytic properties:

Conserved Features:

  • All contain two essential catalytic aspartic acid residues

  • All process prepilins at a conserved -1/+1 junction relative to the cleavage site

  • All require a hydrophobic leader peptide in their substrates

Species-Specific Variations:
Type 4 prepilin peptidases can be broadly categorized into two subclasses:

FeatureType 4a Prepilin PeptidasesType 4b Prepilin Peptidases
Representative EnzymesPilD (P. aeruginosa), PilD (N. meningitidis)TcpJ (V. cholerae), BfpP (E. coli)
Leader LengthShorter (≈6-7 amino acids)Longer (≈13-30 amino acids)
Methylation ActivityOften methylate processed pilinsTypically non-methylating
Substrate RangeNarrow, often process only pilinsBroader, often process pilins and pseudopilins
Catalytic Efficiency (kcat/Km)Generally higher (10^5-10^6 M^-1s^-1)Generally lower (10^3-10^4 M^-1s^-1)
G+1 RequirementAbsolute requirementMore flexible at +1 position

Experimental Comparisons:
Cross-species complementation experiments have shown:

  • TadV from A. actinomycetemcomitans cannot process PilA from P. aeruginosa

  • PilD from P. aeruginosa cannot process Flp1 from A. actinomycetemcomitans

  • Within similar bacterial classes, there is often partial complementation capability

This specificity appears linked to differences in recognition sequences surrounding the cleavage site and potentially to structural differences in the catalytic domains of the enzymes themselves. The evolutionary divergence of these enzymes correlates with the specialization of their secretion systems, highlighting the co-evolution of proteases with their substrate repertoire .

What experimental approaches can be used to investigate the integration of TapD function with the broader Type IV secretion system?

Investigating TapD integration with Type IV secretion systems requires multidisciplinary approaches that connect molecular mechanisms to system-level function:

Protein-Protein Interaction Studies:

  • Bacterial two-hybrid or split-GFP assays to identify direct interactions

  • Co-immunoprecipitation followed by mass spectrometry (IP-MS) to identify interaction partners

  • Förster resonance energy transfer (FRET) to demonstrate proximity in live cells

  • Surface plasmon resonance (SPR) to measure binding affinity and kinetics

Functional Coordination Analysis:

  • Time-resolved studies of protein localization during secretion system assembly

  • Conditional depletion of TapD to determine temporal requirements in secretion

  • Pulse-chase experiments to track substrate processing and incorporation into pili

Structural Integration Approaches:

  • Cryo-electron microscopy of intact secretion complexes

  • In situ cross-linking followed by mass spectrometry (XL-MS)

  • Super-resolution microscopy to map spatial organization

  • Molecular dynamics simulations based on structural data

Genetic Interaction Mapping:

  • Synthetic genetic arrays to identify functional interactions

  • Suppressor screens to identify compensatory mutations

  • Targeted mutagenesis of interface residues identified through structural studies

Experimental Design Example:
To investigate TapD integration with the Tad secretion system in A. actinomycetemcomitans, researchers could employ:

  • Sequential immunoprecipitation of TadV followed by mass spectrometry to identify interaction partners

  • Site-directed mutagenesis of surface residues not involved in catalysis to disrupt protein-protein interactions

  • Fluorescent tagging of TadV and other Tad components to track assembly using time-lapse microscopy

  • Complementation assays using chimeric TadV proteins with domains from different species to map functional interfaces

These approaches would generate a network model of physical and functional interactions between TapD/TadV and the broader secretion machinery, providing insight into how substrate processing is coordinated with subsequent steps in pilus assembly .

How can structural modeling inform the design of specific inhibitors targeting Type 4 prepilin peptidases?

Structural modeling provides critical insights for rational design of specific inhibitors targeting Type 4 prepilin peptidases, following a systematic approach:

Initial Structural Analysis:

  • Homology modeling using known aspartic protease structures as templates

  • Refinement based on evolutionary conservation and mutational data

  • Integration of membrane topology predictions to account for transmembrane domains

  • Molecular dynamics simulations to identify stable conformations

Active Site Characterization:

  • Identification of catalytic aspartic acid residues and surrounding pocket

  • Mapping of substrate binding groove and specificity-determining residues

  • Analysis of water networks and protonation states critical for catalysis

  • Comparison of active sites across bacterial species to identify conserved features

Structure-Based Inhibitor Design:

  • Virtual screening of compound libraries against the active site model

  • Fragment-based approaches targeting subpockets within the active site

  • Transition-state analog design based on the proposed catalytic mechanism

  • Peptidomimetic approaches derived from substrate specificity data

Optimization and Validation:

  • Iterative design cycles with experimental feedback on inhibition potency

  • Assessment of species selectivity to target specific pathogens

  • Evaluation of inhibitor interactions with membrane components

  • Integration of pharmacophore features to improve bioavailability

Case Study Example:
A structure-based design workflow for TapD inhibitors might include:

  • Generation of a homology model based on known aspartic protease structures, with refinement based on the conserved aspartic acid residues identified in experimental studies

  • Docking of substrate-derived peptides to map the binding site

  • Virtual screening of compound libraries against this model

  • Experimental validation of top hits using in vitro processing assays

  • Structural optimization based on structure-activity relationships

  • Assessment of inhibitor effects on biofilm formation and virulence

Given that Type 4 prepilin peptidases represent a novel family of aspartic proteases with unique structural features, inhibitors developed through this process would likely represent new chemical classes distinct from classical aspartic protease inhibitors. The potential for high selectivity makes these enzymes attractive targets for anti-virulence therapeutics with a reduced likelihood of affecting host proteases .

What emerging technologies could advance our understanding of TapD structure-function relationships?

Several cutting-edge technologies hold promise for transforming our understanding of TapD structure-function relationships:

Cryo-Electron Microscopy (Cryo-EM):

  • Recent advances in resolution (now routinely <3Å) make it feasible to determine structures of membrane proteins like TapD

  • Advantages include visualization in a near-native lipid environment and reduced crystallization requirements

  • Could reveal conformational changes during the catalytic cycle

AlphaFold/RoseTTAFold and AI-Powered Structural Prediction:

  • Deep learning approaches now predict membrane protein structures with unprecedented accuracy

  • Can model protein-protein complexes to understand TapD interactions with secretion machinery

  • Enables rapid testing of structural hypotheses before experimental validation

Native Mass Spectrometry:

  • Emerging techniques for membrane proteins can determine oligomeric states and lipid interactions

  • Captures dynamics of substrate binding and processing

  • Can identify post-translational modifications and conformational changes

Single-Molecule Techniques:

  • FRET-based approaches to monitor conformational changes during substrate processing

  • Magnetic tweezers to measure force generation during pilus assembly

  • Super-resolution microscopy to visualize TapD localization and dynamics in live cells

Microfluidics and High-Throughput Screening:

  • Droplet-based assays for rapid screening of TapD variants and substrates

  • Allows testing thousands of conditions to map sequence-function relationships

  • Can be coupled with next-generation sequencing for massively parallel analysis

Integration of these technologies in experimental design:
A comprehensive approach might use AlphaFold to generate initial structural models, validate and refine these using cryo-EM, probe dynamics using single-molecule FRET, and then apply high-throughput mutational scanning to map the catalytic mechanism in unprecedented detail. This multidisciplinary approach would overcome the limitations of individual techniques and provide a more complete understanding of how TapD structure enables its specialized function in prepilin processing .

How might advances in synthetic biology enable the engineering of novel TapD variants with enhanced properties?

Synthetic biology approaches offer exciting opportunities for engineering novel TapD variants with enhanced or altered properties:

Directed Evolution Strategies:

  • Error-prone PCR to generate libraries of TapD variants

  • Selection systems based on bacterial surface display of processed pilins

  • Continuous evolution systems like PACE (Phage-Assisted Continuous Evolution) adapted for membrane proteins

  • Deep mutational scanning to comprehensively map sequence-function relationships

Rational Design Approaches:

  • Computational enzyme design to modify substrate specificity

  • Introduction of non-canonical amino acids at catalytic positions to probe mechanism

  • Domain swapping between TapD variants from different species to create chimeric enzymes

  • Grafting of active site residues onto more stable protein scaffolds

Applications of Engineered TapD Variants:

Engineering GoalApproachPotential Applications
Expanded substrate rangeMutation of specificity-determining residuesProcessing of non-native secretory proteins
Enhanced stabilityConsensus design from multiple homologsImproved expression of recombinant enzyme
Altered catalytic mechanismMutation of catalytic residuesMechanistic studies and novel biotransformations
Regulated activityIncorporation of allosteric switchesConditional control of biofilm formation
Altered membrane topologyManipulation of transmembrane domainsModified integration with secretion machinery

Experimental Design for TapD Engineering:

A comprehensive engineering project might:

  • Create a high-throughput screening system where TapD variants are assessed for their ability to process a reporter protein

  • Generate libraries through both targeted rational design and random mutagenesis

  • Select variants with desired properties (broader specificity, higher activity, altered regulation)

  • Characterize the structural basis for improved properties

  • Test engineered variants in relevant biological contexts (biofilm formation, secretion of heterologous proteins)

Success in this engineering could yield TapD variants useful as research tools, biotechnological enzymes for protein production, or components of synthetic biological systems with programmable assembly properties .

What are the key unresolved questions about the evolutionary history of Type 4 prepilin peptidases across bacterial phyla?

Several critical questions remain unanswered regarding the evolutionary history of Type 4 prepilin peptidases:

Evolutionary Origin:

  • Did Type 4 prepilin peptidases evolve from a common ancestor shared with other aspartic proteases?

  • What was the ancestral function before specialization for prepilin processing?

  • Did the bilobed structure evolve through domain duplication or fusion of distinct proteins?

Phylogenetic Distribution:

  • Why are Type 4 prepilin peptidases widely distributed across both Gram-negative and Gram-positive bacteria but absent in eukaryotes?

  • What explains their presence in some archaeal species despite the divergent cell envelope structure?

  • Are there undiscovered homologs with divergent sequences in uncharacterized bacterial phyla?

Functional Diversification:

  • What evolutionary pressures drove the divergence between methylating (Type 4a) and non-methylating (Type 4b) prepilin peptidases?

  • How did specialization occur between dedicated peptidases for different secretion systems?

  • What role did horizontal gene transfer play in disseminating these systems?

Co-evolution with Substrates:

  • How tightly coupled is the evolution of peptidases with their cognate substrates?

  • Can evolutionary analysis predict substrate specificity from peptidase sequence?

  • What are the minimal sequence requirements for a functional Type 4 prepilin peptidase?

Research Approaches to Address These Questions:

  • Comprehensive phylogenetic analysis incorporating newly sequenced bacterial genomes

  • Ancestral sequence reconstruction and functional characterization of predicted ancestral enzymes

  • Metagenomic mining for novel peptidase variants from uncultured organisms

  • Synteny analysis to track co-evolution of peptidases with secretion system components

  • Experimental testing of cross-species complementation to map functional constraints

Understanding this evolutionary history would not only illuminate the origins of an important class of bacterial enzymes but could also provide insights into the fundamental mechanisms of membrane protein assembly and bacterial secretion system evolution. It may further reveal how these specialized proteases diverged from other aspartic proteases while maintaining the core catalytic mechanism .

What are the most common pitfalls in recombinant expression of Type 4 prepilin peptidases and how can they be overcome?

Recombinant expression of Type 4 prepilin peptidases presents numerous challenges that researchers must navigate:

Common Pitfalls and Solutions:

ChallengeUnderlying CauseSolution Strategies
Low expression levelsToxicity to host cells due to membrane disruption- Use tightly regulated inducible promoters
- Express in C41/C43 E. coli strains designed for toxic proteins
- Lower induction temperature (16-20°C)
- Use lower inducer concentrations
Inclusion body formationPoor membrane integration, protein misfolding- Fusion with solubility-enhancing tags (MBP, NusA)
- Co-expression with chaperones
- Optimize signal sequences for proper membrane targeting
- Add stabilizing ligands during expression
Lack of activityImproper folding, missing co-factors, incorrect pH- Add lipids during purification
- Screen different detergent types and concentrations
- Reconstitute in nanodiscs or liposomes
- Optimize buffer conditions (pH, salt, additives)
Protein instabilityProtease degradation, aggregation- Add protease inhibitors throughout purification
- Minimize freeze-thaw cycles
- Identify and mutate surface-exposed hydrophobic patches
- Optimize storage conditions (glycerol, specific additives)
Difficult purificationMultiple transmembrane domains, detergent interference- Optimize detergent:protein ratios
- Use orthogonal purification approaches
- Consider on-column detergent exchange
- Explore styrene maleic acid lipid particles (SMALPs)

Case Study: Successful Expression Strategy

For recombinant expression of TadV-like peptidases:

  • Clone the gene with an N-terminal pelB signal sequence for proper membrane targeting

  • Express in Lemo21(DE3) strain at 20°C with 0.1 mM IPTG induction

  • Extract using a combination of lysozyme treatment and gentle sonication

  • Solubilize membranes with 1% DDM with overnight incubation

  • Purify using IMAC in the presence of 0.05% DDM

  • Assess activity using synthetic fluorogenic peptide substrates

This approach addresses the key challenges of membrane protein expression while maintaining the native structure required for activity. The critical insight is recognizing that these peptidases require a membrane environment for proper folding and function—strategies that ignore this fundamental property will likely fail .

How can contradictory results in TapD research be reconciled through improved experimental design?

Contradictory results in TapD research often arise from methodological differences that can be reconciled through careful experimental design:

Common Sources of Contradiction and Resolution Approaches:

Substrate Specificity Discrepancies

  • Contradiction: Different studies report varying substrate preferences for the same TapD homolog.

  • Resolution:

    • Standardize substrate concentrations and enzyme:substrate ratios

    • Compare kinetic parameters (kcat/Km) rather than endpoint measurements

    • Ensure consistent reaction conditions (pH, temperature, salt)

    • Use multiple detection methods to confirm processing (SDS-PAGE, mass spectrometry)

Membrane Environment Effects

  • Contradiction: Activity observed in one membrane mimetic but not others.

  • Resolution:

    • Systematically test multiple detergent types and concentrations

    • Compare native membranes, proteoliposomes, and detergent micelles

    • Characterize the lipid dependencies of the enzyme

    • Measure physical parameters of each membrane mimetic

In Vivo vs. In Vitro Discrepancies

  • Contradiction: Processing observed in cells but not with purified components.

  • Resolution:

    • Check for missing cofactors or interacting proteins

    • Examine temporal regulation through time-course studies

    • Consider cellular compartmentalization effects

    • Test activity in crude membrane fractions as an intermediate step

Case Study: Experimental Design to Resolve Contradictions

To resolve contradictory findings about TapD substrate preferences:

  • Multiple Assay Methods:

    • Direct visualization (SDS-PAGE/Western blot)

    • Mass spectrometry for precise cleavage site mapping

    • FRET-based peptide cleavage assays for kinetics

    • In vivo complementation assays

  • Standardized Conditions Matrix:

    • Test activity across pH range (5.5-8.5)

    • Evaluate multiple divalent cation concentrations

    • Compare detergent types systematically

    • Assess temperature dependencies

  • Controls for Each Variable:

    • Catalytically inactive enzyme (D→A mutations)

    • Non-cleavable substrate (G+1→P mutation)

    • Substrate without signal sequence

    • Cross-species enzymes with known specificities

This comprehensive approach allows identification of condition-dependent effects that explain apparent contradictions. The experimental design principles follow the randomized controlled approach outlined for high-quality scientific investigation, with appropriate controls and systematic variation of key parameters3 .

What statistical considerations should be applied when analyzing enzyme kinetics data for Type 4 prepilin peptidases?

Proper statistical analysis of enzyme kinetics data for Type 4 prepilin peptidases requires careful consideration of several factors:

Experimental Design for Statistical Robustness:

  • Replication Requirements:

    • Minimum of 3 biological replicates (independent enzyme preparations)

    • Technical replicates (≥3) for each substrate concentration

    • Include controls in each experimental batch to account for day-to-day variations

  • Substrate Concentration Range:

    • Measure activity across at least 6-8 substrate concentrations

    • Cover range from 0.2×Km to 5×Km when possible

    • Include zero-substrate controls for background correction

  • Time Course Considerations:

    • Ensure measurements are made in initial velocity conditions (<10% substrate consumption)

    • Verify linearity of product formation over the measurement period

    • Account for potential product inhibition at later time points

Statistical Analysis Framework:

  • Model Selection:

    • Test data fit to multiple enzyme kinetics models (Michaelis-Menten, Hill, substrate inhibition)

    • Use Akaike Information Criterion (AIC) or similar metrics to select best-fit model

    • Consider allosteric effects common in membrane enzymes

  • Parameter Estimation:

    • Use weighted non-linear regression when heteroscedasticity is present

    • Report confidence intervals for Km, Vmax, and kcat values

    • Bootstrap analysis for more robust parameter estimation

  • Statistical Tests for Comparisons:

    • Extra sum-of-squares F-test for comparing nested models

    • Analysis of covariance (ANCOVA) for comparing kinetic parameters across conditions

    • Appropriate correction for multiple comparisons (Bonferroni, Holm-Sidak, or FDR)

Example Statistical Analysis Workflow:

For comparing wild-type TapD with a mutant variant:

  • Fit both datasets to Michaelis-Menten equation using weighted non-linear regression

  • Calculate 95% confidence intervals for all parameters

  • Perform extra sum-of-squares F-test to determine if curves are statistically different

  • If significant, identify which specific parameters (Km, kcat or both) differ

  • Report both p-values and effect sizes (magnitude of parameter differences)

ParameterWild-typeD40N MutantStatistical Significance
Km (μM)45.3 (40.1-51.2)128.7 (112.3-148.4)p < 0.001
kcat (min^-1)12.4 (11.7-13.1)0.31 (0.28-0.35)p < 0.001
kcat/Km (mM^-1min^-1)273.72.4p < 0.001

Note: Values in parentheses represent 95% confidence intervals from non-linear regression

This approach ensures statistical rigor in enzyme kinetics analysis, allowing more confident interpretation of results and facilitating comparison across different studies in the literature .

How does understanding TapD mechanism contribute to the broader field of bacterial pathogenesis research?

Understanding TapD mechanism provides critical insights into broader bacterial pathogenesis across multiple dimensions:

Biofilm Formation Mechanisms:

  • TapD/TadV-processed pili are essential for initial surface attachment in diverse pathogens

  • Reveals fundamental mechanisms of bacterial community formation

  • Provides targets for anti-biofilm strategies to combat chronic infections

  • Connects molecular processing events to macroscale biofilm architecture

Virulence Factor Deployment:

  • Type 4 pili systems function as virulence factor deployment platforms

  • Understanding TapD provides insights into regulation of virulence factor secretion

  • Reveals checkpoints in virulence expression that could be targeted therapeutically

  • Explains how bacteria coordinate multiple virulence systems through shared processing machinery

Host-Pathogen Interactions:

  • TapD-processed adhesins mediate direct interactions with host cell receptors

  • Provides molecular basis for tissue tropism of different bacterial pathogens

  • Reveals mechanisms of immune evasion through dynamic pilus modification

  • Connects bacterial attachment capabilities to subsequent infection stages

Horizontal Gene Transfer:

  • Type 4 secretion systems processed by TapD-like enzymes facilitate DNA exchange

  • Contributes to understanding the spread of antibiotic resistance genes

  • Reveals mechanisms of bacterial adaptation during infection

  • Provides insights into bacterial evolution within host environments

Translational Impact:
TapD research directly informs multiple therapeutic approaches:

  • Anti-virulence strategies targeting biofilm formation

  • Vaccine development based on processed pilin antigens

  • Small molecule inhibitors of pilus assembly

  • Diagnostic approaches targeting secreted products of TapD-dependent systems

For example, understanding the specific aspartic acid catalytic mechanism of TadV in A. actinomycetemcomitans has informed structure-based design of inhibitors that could prevent biofilm formation in periodontal disease. Similarly, characterizing the substrate specificity of TapD homologs has revealed conserved epitopes in processed pilins that are being explored as vaccine candidates against multiple pathogens. These applications directly translate fundamental understanding of TapD mechanism into potential clinical interventions .

What insights from enzyme-based therapeutics can be applied to the development of TapD inhibitors as potential antimicrobial agents?

Lessons from successful enzyme-based therapeutics provide valuable guidance for developing TapD inhibitors as antimicrobial agents:

Principles from Existing Enzyme-Based Therapeutics:

  • Target Specificity Strategies:

    • Lessons from approved aspartic protease inhibitors (e.g., HIV protease inhibitors)

    • Transition-state mimetics that exploit unique features of the TapD catalytic mechanism

    • Structure-guided design to target species-specific features while avoiding human proteases

  • Delivery System Innovations:

    • Liposomal formulations to deliver hydrophobic inhibitors to bacterial membranes

    • Nanoparticle-based approaches for targeted delivery to infection sites

    • Biofilm-penetrating formulations based on successful enzyme therapeutics

  • Resistance Management:

    • Multi-target approaches targeting both TapD and other virulence factors

    • Designing inhibitors against highly conserved catalytic residues

    • Combination approaches with conventional antibiotics

Specific Enzyme Therapeutic Precedents:

Therapeutic Enzyme ApproachLesson for TapD Inhibitor Development
PEGylated enzymes (e.g., PEGylated phenylalanine ammonia lyase)Chemical modification strategies to improve pharmacokinetics of TapD-targeting peptides
L-asparaginaseDepletion strategies targeting essential substrates of TapD-dependent pathways
Recombinant human kynureninaseEngineering human proteases to target bacterial-specific cleavage sites as competitive inhibitors
Recombinant collagenase from G. hollisaeOptimization of protease stability and specificity through protein engineering

Experimental Roadmap:

A translational research program for TapD inhibitors might include:

  • High-throughput screening against recombinant TapD using fluorogenic peptide substrates

  • Structure-based optimization of hit compounds

  • Testing in biofilm formation assays as a functional readout

  • Evaluation in infection models, focusing on biofilm-related infections

  • Assessment of resistance development through serial passage experiments

  • Combination studies with conventional antibiotics

The anti-virulence approach targeting TapD offers several advantages over conventional antibiotics, including potentially reduced selection pressure for resistance and specificity for pathogenic bacteria. By applying lessons from successful enzyme-based therapeutics, particularly those targeting other aspartic proteases, researchers can accelerate the development of TapD inhibitors with clinical potential .

How can knowledge of TapD be integrated with systems biology approaches to understand bacterial community dynamics?

Integrating TapD research with systems biology approaches creates powerful frameworks for understanding bacterial community dynamics:

Multi-scale Modeling Approaches:

  • Molecular to Cellular Scale:

    • Kinetic modeling of TapD processing and pilus assembly

    • Agent-based models of pilus-mediated attachment processes

    • Stochastic simulations of gene expression controlling TapD and substrate production

  • Cellular to Community Scale:

    • Biofilm formation models incorporating TapD-dependent adhesion mechanisms

    • Spatial modeling of bacterial community structure based on pilus interactions

    • Ecological models of species interactions mediated by TapD-processed structures

  • Community to Environmental Scale:

    • Metagenomic analysis correlating TapD variants with community composition

    • Modeling environmental factors influencing TapD-dependent biofilm formation

    • Predicting community resilience based on TapD expression patterns

Data Integration Frameworks:

  • Multi-omics Integration:

    • Correlating transcriptomics of TapD/substrates with proteomics and metabolomics

    • Network analysis to identify regulatory hubs controlling TapD expression

    • Connecting TapD activity to global cellular responses using phosphoproteomics

  • Temporal Dynamics Analysis:

    • Time-resolved data collection across scales (gene expression to community structure)

    • Hidden Markov Models to identify state transitions in TapD-dependent processes

    • Identification of critical time points for intervention in biofilm development

Experimental Systems Biology Approaches:

  • High-dimensional Phenotyping:

    • Automated image analysis of biofilm structure under varying conditions

    • Flow cytometry with reporter constructs to track TapD expression at single-cell level

    • Real-time monitoring of adhesion forces using atomic force microscopy

  • Perturbation Analysis:

    • CRISPR interference to create graded knockdowns of TapD and related components

    • Chemical genetic approaches with partial inhibitors of TapD

    • Environmental perturbations to test model predictions about community dynamics

Example Research Design:
A systems biology investigation of TapD in biofilm dynamics might include:

  • Construction of fluorescent reporters for TapD and key substrates

  • Time-lapse microscopy of biofilm formation with single-cell resolution

  • Transcriptomic sampling across the biofilm development timeline

  • Development of a computational model integrating molecular mechanisms with community structure

  • Validation of model predictions using targeted genetic and chemical perturbations

This integrated approach would reveal how molecular processing by TapD propagates through scales to influence community structure and function, providing a mechanistic understanding of biofilm development that could inform more effective control strategies .

What are the current technical limitations in studying Type 4 prepilin peptidases and how might they be addressed?

Current technical limitations in Type 4 prepilin peptidase research present significant challenges that require innovative approaches:

Structural Biology Challenges:

LimitationImpact on ResearchPotential Solutions
Membrane protein crystallization difficultiesLack of high-resolution structures- Utilize cryo-EM for structure determination
- Apply lipidic cubic phase crystallization
- Engineer fusion proteins with crystallization chaperones
Conformational heterogeneityDifficulty capturing catalytic intermediates- Use conformation-specific nanobodies
- Apply time-resolved structural methods
- Employ computational prediction and validation
Lipid environment requirementsArtifacts in non-native conditions- Develop native mass spectrometry approaches
- Utilize nanodiscs or SMALPs to maintain lipid environment
- Apply in-cell structural techniques

Biochemical Analysis Limitations:

LimitationImpact on ResearchPotential Solutions
Low natural abundanceDifficulty studying native enzyme- Develop more sensitive activity assays
- Improve purification from native sources
- Generate antibodies for enrichment
Processing kinetics measurementChallenges in real-time monitoring- Design FRET-based peptide substrates
- Develop continuous assays with coupled enzymes
- Apply single-molecule approaches
Detergent interference with assaysArtifacts in activity measurements- Screen detergent-compatible assay formats
- Compare multiple detergent types systematically
- Develop detergent-free systems (SMALPs)

Genetic Manipulation Challenges:

LimitationImpact on ResearchPotential Solutions
Essential nature in many bacteriaDifficulty creating knockout strains- Implement CRISPR interference for tunable repression
- Develop conditional depletion systems
- Use complementation with mutant variants
Complex phenotypesDifficulty linking molecular to cellular effects- Apply high-content screening approaches
- Develop quantitative biofilm assays
- Utilize microfluidic devices for controlled conditions
Functional redundancyMasked phenotypes in some systems- Create multiple deletion strains
- Apply chemical genetics with selective inhibitors
- Utilize synthetic genetic array approaches

Integrated Strategy to Address Limitations:

A comprehensive approach to overcome these limitations might include:

  • Developing a suite of complementary structural techniques (cryo-EM, HDX-MS, DEER spectroscopy) to address the membrane protein structure challenge

  • Creating a toolkit of fluorogenic peptide substrates for real-time activity monitoring

  • Implementing CRISPR-based approaches for precise genetic manipulation

  • Establishing standardized biofilm assays that connect molecular processing to community phenotypes

By addressing these technical limitations, researchers can overcome current barriers to understanding TapD function and accelerate progress in this challenging field .

How reliable are current models of Type 4 prepilin peptidase function, and what evidence supports or contradicts these models?

Current models of Type 4 prepilin peptidase function have varying levels of reliability, with specific aspects well-supported while others remain speculative:

Well-Established Aspects:

  • Aspartic Protease Mechanism

    • Supporting Evidence:

      • Mutational studies showing absolute requirement for conserved aspartic acid residues

      • Inhibition by classical aspartic protease inhibitors like pepstatin A

      • Conservation of catalytic residues across all identified homologs

    • Strength of Evidence: Very Strong (multiple independent confirmations)

  • Membrane Association Requirement

    • Supporting Evidence:

      • Loss of activity when transmembrane domains are deleted

      • Requirement for detergent solubilization to maintain activity

      • Consistent prediction of membrane topology across homologs

    • Strength of Evidence: Strong (consistent across systems)

  • Leader Peptide Recognition

    • Supporting Evidence:

      • Processing only occurs with substrates containing appropriate leader peptides

      • Conserved cleavage site positioning relative to hydrophobic leader peptide

      • Cross-species studies showing specificity for cognate substrates

    • Strength of Evidence: Strong (multiple substrates tested)

Aspects with Conflicting Evidence:

  • Processing Complex Formation

    • Supporting Evidence:

      • Co-immunoprecipitation studies suggesting interactions with other secretion components

      • Genetic studies showing coordinated expression

    • Contradicting Evidence:

      • In vitro activity of purified enzyme without other components

      • Variable results from different bacterial systems

    • Reliability: Moderate (likely species-specific differences)

  • Processing Timing and Regulation

    • Supporting Evidence:

      • Correlation between environmental signals and prepilin processing

      • Transcriptional studies showing coordinated regulation

    • Contradicting Evidence:

      • Constitutive processing observed in some heterologous systems

      • Limited temporal studies of processing events

    • Reliability: Low to Moderate (more research needed)

Speculative Aspects:

  • Conformational Changes During Catalysis

    • Supporting Evidence:

      • Computational models suggesting movement between lobes

      • Analogies to other aspartic proteases

    • Reliability: Low (lack of direct structural evidence)

  • Substrate Presentation Mechanism

    • Supporting Evidence:

      • Genetic evidence for involvement of other Tad components

      • Analogy to other secretion systems

    • Reliability: Low (limited direct evidence)

Future Directions to Improve Model Reliability:

  • High-resolution structures of TapD/TadV with and without substrate

  • Single-molecule studies of processing kinetics and conformational changes

  • Time-resolved studies correlating processing with pilus assembly

  • Systematic mutagenesis beyond catalytic residues to map substrate interactions

The most reliable aspects of current models focus on the catalytic mechanism and requirement for membrane association, while models of regulation, complex formation, and structural dynamics during catalysis require additional evidence for validation .

What ethical considerations should guide research on inhibiting Type 4 prepilin peptidases as an antimicrobial strategy?

Research on TapD inhibitors as antimicrobials raises important ethical considerations that should guide responsible development:

Responsible Innovation Framework:

  • Antimicrobial Resistance Implications

    • Ethical Question: Could TapD inhibitors contribute to selection pressure for resistance?

    • Guiding Principles:

      • Prioritize anti-virulence approaches that may reduce selection pressure

      • Develop combination strategies with existing antibiotics

      • Establish surveillance protocols to monitor resistance development

      • Design inhibitors targeting highly conserved features to raise resistance barrier

  • Microbiome Impact Assessment

    • Ethical Question: How might TapD inhibitors affect beneficial microbial communities?

    • Guiding Principles:

      • Conduct comprehensive microbiome impact studies during development

      • Develop narrow-spectrum approaches targeting pathogen-specific features

      • Consider delivery strategies that limit systemic exposure

      • Balance effective dosing with microbiome preservation

  • Access and Global Health Equity

    • Ethical Question: How can we ensure global access to novel antimicrobials?

    • Guiding Principles:

      • Consider affordability and scalability in early development stages

      • Explore open-source approaches to accelerate research

      • Develop formulations appropriate for resource-limited settings

      • Create equitable licensing models to ensure global access

  • Research Resource Allocation

    • Ethical Question: Is TapD inhibition the most effective approach for resource investment?

    • Guiding Principles:

      • Compare cost-effectiveness with alternative antimicrobial strategies

      • Prioritize pathogens with highest clinical need

      • Balance basic mechanism studies with translational development

      • Consider dual-use applications (e.g., research tools and therapeutics)

Ethical Research Design Guidelines:

Research StageEthical ConsiderationsImplementation Approach
Target ValidationJustification for new antimicrobial targets- Document unmet medical needs
- Demonstrate advantages over existing approaches
- Consider anticipated resistance development
Inhibitor DevelopmentBalance between efficacy and selectivity- Screen for human protease cross-reactivity
- Develop assays for microbiome impact
- Prioritize pathogen-specific targeting
Preclinical TestingAnimal welfare and translation relevance- Apply 3Rs principles (Replacement, Reduction, Refinement)
- Utilize ex vivo and in vitro biofilm models when possible
- Design studies with clinical relevance as priority
Clinical DevelopmentPatient benefits and risks- Engage patient advocates in study design- Ensure diverse population representation- Develop clear risk communication strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.