Recombinant Type II secretion system protein F (exeF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
exeF; Type II secretion system protein F; T2SS protein F; General secretion pathway protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Aeromonas hydrophila
Target Names
exeF
Target Protein Sequence
MTEGDSARQVRQQLREQGLTPLEVNETTEKAKREANRFVLFRRGASTSELALITRQLATL VGAGLTIEEALRAVAEQCEKAHLRSLVATVRSKVVEGYSLADSLGAFPHVFDQLFRSMVA AGEKSGHLEKVLNRLADYTEQRQHMRTKLLQAMIYPIVLTLVAVGVISILLTAVVPKVVA QFEHMGQQLPATTRFLIGTSELMQHYGLWFLLLLFIGGFVWRWWLTDEKRRRHWHQVVLR LPVIGRVSRGLNTARFARTLSILNASAVPLLEGMKIAGEVLSNDFARTRIGEATERVREG TSLRKALDETKIFPPMMLHMIASGEQSGELDSMLERAADNQDREFETQVNIALGVFEPLL VVSMAGVVLFIVMSILQPILELNNMVNL
Uniprot No.

Target Background

Function

Component of the type II secretion system inner membrane complex. It is essential for the energy-dependent secretion of extracellular factors, such as proteases and toxins, from the periplasm.

Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Type II Secretion System and what is its significance in bacterial physiology?

The Type II Secretion System (T2SS) is a cell envelope-spanning macromolecular complex prevalent in Gram-negative bacteria that translocates a wide range of proteins from the periplasm across the outer membrane . The system is composed of a core set of highly conserved proteins that assemble:

  • An inner membrane platform

  • A periplasmic pseudopilus

  • An outer membrane complex termed the secretin

In many bacterial species including Aeromonas hydrophila and Vibrio vulnificus, the T2SS serves as the predominant virulence mechanism by secreting protein toxins such as aerolysin . The system functions as a molecular piston-like structure with a surface pore (secretin) that together use energy to transport proteins out of the bacterial cell . This secretion pathway is essential for bacterial adaptation to various environmental conditions and plays a crucial role in pathogenesis .

What is the specific role of ExeF in the Type II Secretion System?

ExeF is an integral component of the inner membrane platform of the T2SS, which serves as the nexus of the system . This platform:

  • Interacts with the periplasmic filamentous pseudopilus

  • Connects with the dodecameric outer membrane complex (secretin)

  • Engages with the cytoplasmic secretion ATPase

These coordinated interactions orchestrate the secretion process . ExeF specifically participates in the assembly of the secretion apparatus and contributes to the energy coupling mechanism that drives protein transport. The exeF gene is part of the exe operon in A. hydrophila, which encodes multiple components of the T2SS machinery .

What are the most effective expression systems for producing recombinant ExeF?

For optimal expression of recombinant ExeF, researchers should consider the following approaches based on published methodologies:

Table 1: Comparison of Expression Systems for Recombinant ExeF Production

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coli BL21(DE3)High yield, well-established protocolsPotential improper folding of membrane proteins37°C in M9 medium, IPTG induction at 0.4 mM
Cell-free systemsAvoids toxicity issues, rapid productionLower yields, higher costAddition of lipid nanodiscs for membrane proteins
Homologous expression in AeromonasNative folding environmentMore complex genetic manipulationInducible promoters with controlled expression

For in vitro transcription-translation reactions, the following protocol has been successfully employed:

  • Subclone the exeF gene downstream of the lac promoter in appropriate vectors (e.g., pBluescript)

  • Induce with IPTG at 0.4 mM and incubate at 37°C

  • Add rifampin (200 μg/ml) after 30 minutes to inhibit endogenous RNA synthesis

  • Label with [35S]methionine (100 μCi/ml) and chase with unlabeled methionine (0.25 mg/ml)

  • Collect samples at various time points (1, 15, 30, and 60 minutes) for analysis by SDS-PAGE and autoradiography

How can researchers effectively isolate and purify recombinant ExeF for structural studies?

Purification of ExeF presents challenges due to its membrane-associated nature. A methodical approach includes:

  • Membrane Extraction:

    • Use mild detergents (DDM, LDAO) to solubilize ExeF from membranes

    • Optimize detergent concentration to maintain protein stability and function

  • Affinity Chromatography:

    • Utilize fusion tags such as His-tag and MBP (Maltose-Binding Protein) as demonstrated in previous studies

    • Include TEV protease cleavage sites for tag removal

  • Size Exclusion Chromatography:

    • Final purification step to ensure homogeneity

    • Buffer optimization to maintain native conformation

  • Stability Assessment:

    • Monitor protein stability using thermal shift assays

    • Identify optimal buffer conditions for downstream applications

The design of fusion proteins has been critical for successful purification, as demonstrated in previous research with related T2SS components where His-tagged MBP fusions with TEV cleavage sites were employed .

What techniques are most effective for studying ExeF interactions with other T2SS components?

Several complementary approaches have proven valuable for investigating ExeF interactions:

  • In vivo Cross-linking:

    • Captures transient protein-protein interactions within the cellular environment

    • Has been successfully applied to identify interactions between ExeA and peptidoglycan

    • Chemical cross-linkers with various spacer lengths can capture different spatial relationships

  • Co-immunoprecipitation:

    • Isolates native protein complexes containing ExeF

    • Requires specific antibodies against ExeF or epitope tags

  • Bacterial Two-Hybrid Systems:

    • Enables screening for potential interaction partners

    • Suitable for mapping interaction domains

  • Surface Plasmon Resonance (SPR):

    • Provides quantitative binding kinetics

    • Has been used to study exoprotein interactions with periplasmic domains of GspD and GspC as well as with pseudopilus tip components

  • Cryo-electron Microscopy:

    • Reveals structural details of assembled complexes

    • Has been employed to determine structures of related T2SS components at approximately 3.5 Å resolution

How do mutations in exeF affect the assembly and function of the T2SS?

Mutational analysis of exeF provides critical insights into its function within the T2SS. Key observations include:

  • Impact on Secretin Assembly:

    • Mutations in exeF can disrupt the formation of the secretin complex in the outer membrane

    • This leads to accumulation of unassembled secretin monomers

  • Effects on Protein Secretion:

    • Disruption of exeF function results in decreased secretion of extracellular proteins including lipases and toxins

    • The severity of secretion defects correlates with the nature of the mutation

  • Methodological Approach to Mutation Analysis:

    • Site-directed mutagenesis targeting conserved residues

    • Marker exchange mutagenesis to create chromosomal mutations

    • Complementation studies to confirm phenotypes

A systematic approach to studying exeF mutations involves:

  • Creating a library of mutations (substitution, deletion, insertion)

  • Assessing secretion phenotypes using enzyme activity assays

  • Analyzing secretin complex formation by non-denaturing gel electrophoresis

  • Determining localization of T2SS components by subcellular fractionation

How does ExeF compare to homologous proteins in other bacterial species?

Comparative analysis reveals important insights about the conservation and specialization of ExeF across bacterial species:

Table 2: Comparison of ExeF Homologs Across Bacterial Species

SpeciesProtein NameSequence Identity to ExeFKey Functional DifferencesReference
Aeromonas hydrophilaExeF100% (reference)Interacts with ExeE; critical for secretin assembly
Vibrio choleraeEpsFHigh similarityPart of system that requires pilotin EpsS
Pseudomonas aeruginosaXcpSSignificant homologyFunctions in a system that can exchange components with XphA/XqhA
Klebsiella oxytocaPulFStrong sequence similarityPart of the pullulanase secretion system

The T2SS components from exeG to exeN show strong sequence similarity to the pul genes required for pullulanase secretion in K. oxytoca, as well as the xcp genes of P. aeruginosa . This conservation suggests functional importance across diverse bacterial species.

How does the biogenesis of the T2SS differ between species that have ExeF versus those that utilize alternative components?

The biogenesis of T2SS shows interesting variations across bacterial species:

  • In Aeromonas hydrophila:

    • The Exe T2SS is encoded by two operons, exeC-N and exeAB

    • Assembly of the ExeD secretin is dependent on the inner membrane complex ExeAB

    • No GspS pilotin homolog is found in A. hydrophila

    • ExeA contains a peptidoglycan binding motif that is critical for ExeD secretin assembly

  • In Vibrio vulnificus:

    • Secretin assembly requires the coordinated activity of both the accessory complex EpsAB and the pilotin EpsS

    • The C-terminal region of the secretin carries a signature motif necessary for pilotin-dependent assembly

  • Methodological Approaches to Study These Differences:

    • Cryo-electron microscopy to determine secretin structures

    • Crystal structure determination of pilotins

    • Genetic complementation experiments between species

    • Domain swapping to identify critical regions

The key difference appears to be in the mechanism of secretin assembly, with some species (like A. hydrophila) using primarily the ExeAB complex, while others (like V. vulnificus) require both an accessory complex and a pilotin protein .

What are the common difficulties in working with recombinant ExeF and how can they be overcome?

Researchers working with ExeF face several technical challenges:

  • Protein Insolubility:

    • ExeF is a membrane-associated protein, making it difficult to solubilize while maintaining native structure

    • Solution: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or incorporate lipid nanodiscs during purification

  • Low Expression Levels:

    • Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage, use specialized expression strains (C41/C43), and lower induction temperature to 16-20°C

  • Protein Instability:

    • Purified ExeF may exhibit limited stability in solution

    • Solution: Screen buffer conditions including pH, salt concentration, and stabilizing additives

  • Functional Reconstitution:

    • Demonstrating activity of purified ExeF is challenging

    • Solution: Develop in vitro reconstitution assays with other T2SS components, potentially using liposomes to mimic membrane environment

  • Structural Analysis Limitations:

    • Membrane proteins are challenging targets for structural studies

    • Solution: Consider fusion with crystallization chaperones, use conformation-specific antibodies, or employ cryo-EM approaches

How can contradictory data about ExeF function be reconciled?

When faced with contradictory results regarding ExeF function, researchers should:

  • Examine Experimental Conditions:

    • Different bacterial strains may show varying phenotypes

    • Growth conditions can affect T2SS assembly and function

    • Ensure comparable experimental parameters across studies

  • Consider Redundancy:

    • Some bacteria possess multiple secretion systems with overlapping functions

    • The presence of homologous proteins (like XphA/XqhA in P. aeruginosa) can complement ExeF function

  • Methodological Approach to Resolve Contradictions:

    • Perform side-by-side comparisons using standardized protocols

    • Utilize multiple complementary techniques to verify results

    • Consider genetic backgrounds and potential compensatory mechanisms

  • Statistical Analysis:

    • Employ appropriate statistical methods to determine significance of observed differences

    • Conduct meta-analysis of published data when sufficient studies exist

What are the emerging techniques for studying the dynamics of ExeF within the assembled T2SS?

Several cutting-edge approaches are advancing our understanding of ExeF dynamics:

  • Single-Molecule Techniques:

    • Single-molecule FRET to track conformational changes during the secretion cycle

    • Super-resolution microscopy to visualize T2SS assembly in living cells

  • Time-Resolved Cryo-EM:

    • Capturing different states of the T2SS during the secretion process

    • Providing insights into the conformational changes of ExeF during function

  • Molecular Dynamics Simulations:

    • Modeling ExeF interactions with other T2SS components

    • Predicting conformational changes upon ATP binding and hydrolysis

  • In-cell NMR:

    • Investigating the dynamics of labeled ExeF in a native-like environment

    • Detecting structural changes under different physiological conditions

How might structural information about ExeF inform the development of novel antimicrobial strategies?

Understanding ExeF structure and function offers potential for antimicrobial development:

  • Targeting Protein-Protein Interactions:

    • Identify critical interfaces between ExeF and other T2SS components

    • Design small molecules or peptides that disrupt these interactions

  • Inhibiting Energy Coupling:

    • Target the coupling between the ATPase activity of GspE and the conformational changes in ExeF

    • Develop compounds that prevent energy transduction within the T2SS

  • Methodological Approaches:

    • Structure-based drug design using high-resolution structures

    • Fragment-based screening against ExeF

    • Peptide mimetics that compete with natural binding partners

  • Validation Strategies:

    • Bacterial growth assays in the presence of potential inhibitors

    • Protein secretion assays to confirm T2SS inhibition

    • In vivo infection models to assess efficacy

The targeted inhibition of T2SS function represents a promising approach for combating bacterial pathogens that rely on this system for virulence, including A. hydrophila and V. vulnificus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.