Recombinant Type II secretion system protein F (outF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its implementation.
Synonyms
outF; Type II secretion system protein F; T2SS protein F; General secretion pathway protein F; Pectic enzymes secretion protein OutF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi)
Target Names
outF
Target Protein Sequence
MALFQYQALNAQGKKSQGMQEADSARHARQLLREKGLVPVKIEEQRGEAAPRSGFSLSFG RSHRIASDLALLTRQLATLVAALPLEEALDAVAKQSEKPKLSALMAAVRAKVVEGHSLAE AMGNFPGSFERLYCAMVAAGEASGHLDAVLNRLADYTEQRHEMRSRIQQAMIYPCVLTLV AISVVSILLSAVVPKVVEQFIHMKQALPLSTRLLMSASDAVRTYGPWVVLLLVLAIMGFR VLLRQEKHRLVFHRRLLFLPVVGRVARGLNTARYARTLSILNSSAVPLLQAMRISGDVLT NDYARFRLGQATDAVREGVTLHKALEQTALFPPMMRHMIASERRRARRHVNPRGDNQDRE FSAQMTLVLGLFEPLLVVSMAGIVLFIVLAILQPILQLNTLMSM
Uniprot No.

Target Background

Function
A component of the type II secretion system's inner membrane complex. It is essential for the energy-dependent secretion of extracellular factors, such as proteases and toxins, from the periplasm.
Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Type II Secretion System Protein F (OutF) and what is its role in bacterial secretion?

Type II Secretion System protein F (OutF) is a critical component of the inner membrane platform of the Type II Secretion System (T2SS) in Gram-negative bacteria. The T2SS is a sophisticated molecular machine that transports folded proteins from the periplasm across the outer membrane into the extracellular environment.

OutF is one of the core proteins (along with GspC, GspE, GspL, and GspM) that form the inner membrane platform, which serves as the nexus of the system. This platform interacts with:

  • The periplasmic pseudopilus

  • The outer membrane secretin complex

  • The cytoplasmic secretion ATPase

The inner membrane platform containing OutF plays a crucial role in converting conformational changes in the ATPase (due to ATP hydrolysis) into an extension of the pseudopilus, which is thought to function as a piston that pushes exoproteins through the outer membrane channel .

How is the T2SS organized structurally and how does OutF fit into this architecture?

The Type II Secretion System has a complex architecture spanning the bacterial cell envelope with multiple subassemblies:

T2SS Architecture Components:

  • Inner Membrane Platform: Contains OutF along with GspC, GspE, GspL, and GspM proteins

  • Periplasmic Pseudopilus: Composed of GspG (major pseudopilin) and GspH-K (minor pseudopilins)

  • Outer Membrane Complex: Primarily formed by the secretin GspD

  • Secretion ATPase: GspE, which provides energy through ATP hydrolysis

OutF is specifically positioned in the inner membrane platform, where it participates in protein-protein interactions that connect the cytoplasmic and periplasmic components of the system. The inner membrane platform is responsible for contacting the outer membrane complex in the periplasm, the ATPase in the cytoplasm, and the major pseudopilin .

The current model suggests that the inner membrane platform acts as an intermediary, transmitting the energy from ATP hydrolysis by GspE to mechanical movement of the pseudopilus, which then facilitates protein secretion through the outer membrane secretin channel .

What expression systems are commonly used for recombinant OutF production?

Multiple expression systems have been utilized for the production of recombinant Type II secretion system protein F, with Escherichia coli being the predominant host. According to the available research data, the following expression systems have been successfully employed:

Common Expression Systems for OutF:

  • E. coli: The most widely used system due to its rapid growth, well-established genetic tools, and cost-effectiveness

  • Yeast: Used when post-translational modifications may be required

  • Baculovirus-infected insect cells: For potentially improved protein folding

  • Mammalian cell expression systems: Used for specific structural studies

  • Cell-free expression systems: For direct production without cellular constraints

Each system has specific advantages depending on research objectives. For instance, E. coli expression typically yields 85% or greater purity as determined by SDS-PAGE analysis . The expression system choice should be guided by the downstream applications and the structural integrity requirements of the recombinant protein.

What are common challenges in purifying recombinant OutF protein?

Purification of recombinant OutF presents several challenges that researchers must address to obtain functional protein:

Major Purification Challenges:

  • Membrane protein solubility: As an inner membrane protein, OutF has hydrophobic domains that can lead to aggregation and insolubility during expression and purification

  • Proper protein folding: Ensuring the correct tertiary structure is maintained during extraction from the membrane environment

  • Protein stability: Maintaining stability during the purification process, especially during detergent exchange steps

  • Protein-protein interactions: Preserving interaction capabilities with other T2SS components

  • Yield limitations: Typical yields of purified OutF can be affected by expression conditions and purification methods

Common Solutions:

  • Use of appropriate detergents or amphipols to maintain protein solubility

  • Addition of stabilizing agents during purification

  • N-terminal His-tag or other affinity tags for improved purification efficiency

  • Storage in Tris/PBS-based buffers with 6% trehalose at pH 8.0 to maintain stability

  • Optimization of reconstitution protocols using deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage

Researchers typically achieve greater than 90% purity as determined by SDS-PAGE when using optimized protocols .

How can experimental design optimization improve recombinant OutF expression?

Optimizing the expression of recombinant OutF protein benefits significantly from applying Design of Experiments (DoE) methodology rather than traditional univariate approaches. This multivariate statistical method allows researchers to:

  • Evaluate multiple variables simultaneously

  • Identify statistically significant factors

  • Account for interactions between variables

  • Quantify experimental error

  • Gather high-quality information with fewer experiments

Key Variables to Optimize in DoE for OutF Expression:

  • Media composition (concentrations of yeast extract, tryptone)

  • Carbon source concentrations (glucose, glycerol)

  • Antibiotic concentration

  • Inducer concentration (typically IPTG)

  • Cell density at induction (OD600)

  • Expression temperature

  • Expression time

  • pH and ionic strength

Sample DoE Results from Related Protein Expression:

VariableEffect on Cell Growthp-valueEffect on Activityp-valueEffect on Productivityp-value
Induction OD600+1.43<0.0001+323.50.0016+0.330.2248
IPTG concentration-0.420.0387-52.00.5422-0.190.4720
Expression temperature+1.13<0.0001-340.80.0011-0.910.0041
Yeast extract+0.860.0004+77.00.3706+0.230.3930
Tryptone+0.670.0027+268.20.0061+0.790.0095
Glucose-0.330.0920+164.30.0685+0.370.1797

Using DoE methodology, researchers have achieved up to 250 mg/L of soluble recombinant protein expression in E. coli with ~75% homogeneity for similar membrane-associated proteins .

What are the structural determinants of OutF's interaction with other T2SS components?

The structural basis for OutF's interactions within the T2SS complex involves specific domains that facilitate protein-protein interactions critical for system assembly and function:

Key Structural Determinants:

  • Cytoplasmic N-terminal Domain:

    • Interacts with the cytoplasmic ATPase GspE

    • Contains conserved motifs that facilitate energy transduction from ATP hydrolysis

  • Transmembrane Domains:

    • Anchor the protein in the inner membrane

    • Form part of the inner membrane platform structure

    • Contribute to the stability of the multiprotein complex

  • Periplasmic Domains:

    • Interact with other inner membrane components (GspC, GspL, GspM)

    • May form connections to the pseudopilus structure

    • Potentially contribute to substrate recognition

Structural studies utilizing X-ray crystallography and cryo-electron microscopy have revealed that the inner membrane platform proteins, including OutF, assemble into a ring-like structure that coordinates with both the secretion ATPase and the pseudopilus assembly .

Recent models suggest OutF functions within a hexameric arrangement that transmits conformational changes from the ATPase to the pseudopilus components, acting as a molecular "transmission" system for the mechanical force generated by ATP hydrolysis .

How does the Type II secretion pathway function mechanistically and what role does OutF play?

The Type II secretion pathway operates through a complex series of molecular events in which OutF plays a central role in the mechanical transduction process:

Mechanistic Steps of T2SS:

  • Substrate Recognition and Loading:

    • Exoproteins are synthesized with N-terminal signal peptides

    • Translocation across inner membrane via Sec or Tat pathways

    • Signal peptide removal in periplasm

    • Folding of proteins in the periplasm

    • Recognition of folded exoproteins by periplasmic domains of GspD, GspC, and/or pseudopilus tip

  • Energy Generation and Transmission:

    • ATP binding and hydrolysis by the cytoplasmic ATPase GspE

    • Conformational changes in GspE transmitted to the inner membrane platform

    • OutF participates in converting these conformational changes into mechanical force

  • Pseudopilus Extension:

    • Addition of pseudopilin subunits (GspG) to the growing pseudopilus

    • Extension of pseudopilus acts as a piston mechanism

  • Exoprotein Transport:

    • Pushing of exoproteins through the secretin channel by the pseudopilus

    • Release of exoproteins to the extracellular environment

OutF's specific role involves receiving conformational signals from the ATPase GspE and transmitting them to the pseudopilus assembly machinery . The ATPase activity of GspE (the T2SS homolog in V. cholerae) has been shown to be greatly increased by the cytoplasmic domain of GspL and acidic phospholipids, suggesting a coordinated activation mechanism involving multiple inner membrane platform components including OutF .

What regulatory factors control T2SS gene expression and protein secretion?

The Type II secretion system is regulated by a complex network of factors that ensure appropriate timing and efficiency of protein secretion:

Major Regulatory Factors:

  • Growth Phase-Dependent Expression:

    • T2SS genes and substrate proteins show expression patterns tied to bacterial growth phases

    • This ensures secretion occurs at optimal times for bacterial survival or virulence

  • Stress Response Systems:

    • The σᴱ stress response pathway directly regulates T2SS expression

    • The upstream region of T2SS operons contains both σᴱ and σ⁷⁰ binding sequences

    • Deletion of σᴱ binding sequences prevents transcriptional activation of T2SS

    • Ectopic overexpression of σᴱ stimulates T2SS transcription

  • Second Messenger Signaling:

    • 3',5'-cyclic diguanylic acid (c-di-GMP) is involved in regulating T2SS expression

    • This links secretion to broader bacterial signaling networks

  • Metabolic Regulation:

    • Phosphate metabolism affects T2SS transcriptional expression

    • This connects secretion to the nutritional status of the bacterium

These regulatory mechanisms ensure that the energy-intensive process of protein secretion is coordinated with bacterial needs and environmental conditions. For OutF specifically, its expression as part of the T2SS operon is controlled by these broader regulatory networks, ensuring it is produced in appropriate stoichiometric ratios with other system components.

What methodological approaches can be used to study the assembly and function of the T2SS containing OutF?

Several complementary methodological approaches are valuable for investigating OutF's role in T2SS assembly and function:

Structural Analysis Methods:

  • X-ray Crystallography: Determines atomic resolution structures of OutF domains

  • Cryo-Electron Microscopy: Visualizes larger T2SS complexes containing OutF

  • Nuclear Magnetic Resonance (NMR): Studies dynamics and interactions of soluble domains

Functional Analysis Methods:

  • Site-Directed Mutagenesis: Tests the importance of specific residues in OutF function

  • Secretion Assays: Quantifies the impact of OutF modifications on substrate secretion

    • Example: Immunoblot analysis of secreted proteins like RbmC, RbmA, and Bap1

    • Dot blot analysis of fractions for secreted proteins

    • Enzymatic activity assays for secreted enzymes (e.g., alkaline phosphatase, hemolytic activity)

Interaction Analysis Methods:

  • Bacterial Two-Hybrid Assays: Identifies protein-protein interactions

  • Surface Plasmon Resonance (SPR): Quantifies binding kinetics between OutF and other T2SS components

  • Co-Immunoprecipitation: Confirms interactions in cellular contexts

  • Cross-linking coupled with Mass Spectrometry: Maps interaction interfaces

In vivo Imaging Methods:

  • Fluorescence Microscopy: Tracks localization and dynamics of fluorescently tagged OutF

  • Super-Resolution Microscopy: Provides detailed spatial organization of T2SS components

A comprehensive investigation would typically combine multiple approaches. For example, researchers have used immunoblot analyses to demonstrate that T2SS mutants lacking functional secretion components fail to secrete biofilm matrix proteins like RbmC, RbmA, and Bap1, even though these proteins accumulate in the cell fractions—indicating a secretion defect rather than a production defect .

How can protein engineering approaches be applied to study or improve OutF function?

Protein engineering offers powerful tools for both basic research on OutF function and potential biotechnological applications:

Engineering Approaches for OutF:

  • Domain Swapping:

    • Exchanging domains between OutF homologs from different bacterial species

    • Identifies species-specific functional elements

    • Tests compatibility between T2SS components from different organisms

  • Fusion Protein Construction:

    • Creating OutF fusions with reporter proteins

    • Enables tracking of localization and dynamics

    • Can be used to develop biosensors for T2SS activity

  • Rational Design of Mutations:

    • Targeting conserved residues based on sequence alignments

    • Modifying putative interaction interfaces

    • Engineering disulfide bonds to stabilize protein conformations

  • Directed Evolution:

    • Creating libraries of OutF variants

    • Selecting for improved properties (stability, interaction specificity)

    • Identifying variants with enhanced secretion capabilities

  • Beta-Barrel Structure Modification:

    • Recent research on similar secretion systems suggests that beta-barrel structures play critical roles in protein secretion

    • Deleting N-terminal amino acids (10-20) has been shown to significantly reduce secretion ability in related systems

    • This approach could be applied to OutF to study structure-function relationships

When applying these approaches, researchers should consider the potential impact on:

  • Protein solubility and stability

  • Interaction with other T2SS components

  • Assembly of the full T2SS complex

  • Specificity for secreted substrates

Experiments have shown that even small modifications can significantly impact function. For example, in a similar system, deletion of N-terminal sequences reduced secretion efficiency from over 90% to less than 25% after 4 days of cultivation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.