Recombinant Type II secretion system protein L (exeL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
exeL; Type II secretion system protein L; T2SS protein L; General secretion pathway protein L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Aeromonas hydrophila
Target Names
exeL
Target Protein Sequence
MAGEIFVSESLVIRLGTNAQQPVEWLVWSAKEEEIIASGILASAHALGELRERAGGRPVV TLVPGSDLIFRRVSLPGKYSRQAAAALPYLLEEQIASDVDELHLVVLGHEGHEVDLMAVD KEKMQIWLGWLQQAGLKSQQLLPDVLALPPAADGWSALQLGKEWLLRQGPCQGIVADESL LAMLLAAEADPVTIHSHTPLPAIPAANWLAADPELPMLLLAKGALNCQANLLQGPYRPQT EYSRYWLQWRKVAVVAGLLLLVALTQRGMHLYQLAEQDKALKAEIRQVYTRIFPGENRIV NVRSQMAQHLKLLGQTPQDGVLLLLTELAPTFAEVPGLKPQVLRFDAARGELRLQVTAPG FAEIERFRELAGKRFEVQQGEGAQHRGQG
Uniprot No.

Target Background

Function
Recombinant Type II secretion system protein L (ExeL) is an inner membrane component crucial for the energy-dependent secretion of extracellular factors, such as proteases and toxins, from the periplasm. It plays a vital role in complex assembly, recruiting ExeM to form a stable inner membrane complex. This complex functionally links the cytoplasmic energy-providing ExeE protein to the remaining T2SS machinery.
Protein Families
GSP L family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Type II Secretion System and how does ExeL fit within this complex?

The Type II Secretion System (T2SS) is a cell envelope-spanning macromolecular complex prevalent in Gram-negative bacterial species. It serves as the predominant virulence mechanism for many bacteria including Vibrio vulnificus and Aeromonas hydrophila. The system consists of a core set of highly conserved proteins that assemble an inner membrane platform, a periplasmic pseudopilus, and an outer membrane complex called the secretin .

ExeL is a component of the T2SS in A. hydrophila, where the secretion apparatus is referred to as the Exe system. While the search results don't provide specific details about ExeL's function, it likely works in conjunction with other Exe proteins, such as the secretin ExeD, which forms the outer membrane pore essential for toxin secretion .

How does the Type II Secretion System contribute to bacterial virulence?

The T2SS functions as a molecular piston-like structure with a pore (secretin) that transports toxic proteins out of the bacterial cell into the infected host . In pathogenic E. coli strains, T2SS secretes SslE, an outer membrane lipoprotein essential for biofilm formation. Studies with rabbit-specific EPEC strains demonstrate that mutations in either the T2SS or SslE result in significantly reduced intestinal colonization and milder disease symptoms .

The intact T2SS is crucial for membrane integrity and toxin secretion, as demonstrated in V. vulnificus. Proper assembly of the secretin component is essential for full T2SS function and bacterial virulence .

What structural characteristics define T2SS components like ExeL?

T2SS components exhibit highly conserved structural features across different bacterial species. For secretin proteins (like ExeD in A. hydrophila), cryo-electron microscopy has revealed pentadecameric (15-subunit) stoichiometries with distinctive C-terminal regions . The assembly mechanisms of T2SS components can be either pilotin-dependent or pilotin-independent, with specific signature motifs identifying the assembly pathway .

How should researchers design optimal experiments for studying ExeL function?

Researchers should apply systematic experimental design principles when studying ExeL function. The optimal design approach allows for tailor-made experiments with any number of observations, experimental variables (qualitative or quantitative), and model types (linear or nonlinear) . Key considerations include:

  • Variable identification: Determine which factors might affect ExeL function, such as pH, temperature, salt concentration, and interacting partners.

  • Experimental constraints: Account for any limitations on experimental conditions.

  • Statistical power: Design experiments with sufficient replicates and controls to enable robust statistical analysis.

  • Interactive approach: Use spreadsheet-based tools to build necessary matrices for experimental design, allowing for interactive modification and improvement of parameter estimators .

For complex experiments, researchers can employ optimization software readily available in spreadsheet programs to identify optimal experimental conditions .

What crystallization strategies work best for structural studies of recombinant ExeL?

For structural studies of recombinant ExeL, researchers should consider implementing an Associative Experimental Design (AED) approach. This method has proven successful for protein crystallization by:

  • Analyzing initial screening results to determine factors in chemical space most likely to lead to higher-scoring outcomes (crystals) .

  • Generating candidate crystallization cocktails based on these analyses rather than simply optimizing existing conditions .

  • Eliminating prohibited combinations and prioritizing reagents based on AED analysis of preliminary results .

This approach has successfully generated novel crystallization conditions for various proteins, including Nucleoside diphosphate kinase (4 novel conditions), HAD superfamily hydrolase (2 conditions), and Nucleoside kinase (1 condition) . The methodology allows for the exploration of new reagent combinations rather than just modifying pH, concentration of precipitants, and salts as in traditional optimization approaches .

How can researchers effectively investigate ExeL interactions with other T2SS components?

To investigate ExeL interactions with other T2SS components, researchers should employ a multi-method approach similar to that used for studying secretin assembly mechanisms:

  • Structural biology techniques: Utilize cryo-electron microscopy (as employed for secretin structures at ~3.5 Å resolution) and X-ray crystallography (as used for the V. vulnificus EpsS pilotin) to determine the structural basis of interactions .

  • Mutational analysis: Create targeted mutations in regions likely involved in protein-protein interactions, similar to studies of the S-domain in ExeD .

  • Fractionation studies: Employ isopycnic sucrose-density-gradient ultracentrifugation to separate inner and outer membranes and track the localization of wild-type and mutant proteins .

  • Functional assays: Assess the impact of mutations on T2SS functionality through toxin secretion and virulence assays .

By combining these approaches, researchers can establish the molecular basis for ExeL interactions and its role within the larger T2SS complex.

How should researchers handle contradictory results in ExeL functional studies?

When confronted with contradictory results in ExeL functional studies, researchers should follow a systematic approach to resolution:

  • Verify data integrity by re-examining original datasets and experimental protocols .

  • Review methodological differences that might explain inconsistencies, including buffer compositions, protein preparation methods, and assay conditions .

  • Check assumptions underlying each experiment, as different interpretations of the same data can lead to apparent contradictions .

  • Implement collaborative investigation, bringing together researchers with complementary expertise to analyze the contradictions from multiple perspectives .

  • Design critical experiments specifically aimed at resolving the contradiction, testing competing hypotheses directly .

This systematic approach transforms contradictions from obstacles into opportunities for deeper understanding of ExeL function and its context-dependent behavior.

What statistical methods are most appropriate for analyzing ExeL mutant phenotypes?

For analyzing ExeL mutant phenotypes, researchers should employ robust statistical methods that account for the complexity of biological systems:

  • Implement optimal design of experiments approaches that maximize the information gained while minimizing the number of experiments required .

  • Use appropriate matrices for data analysis, which can be constructed using spreadsheet software as described for teaching optimal design of experiments .

  • Apply models that accurately reflect the relationship between experimental variables and observed phenotypes, whether linear or nonlinear in parameters .

  • Consider constraints imposed on experimental variables and incorporate these into the statistical analysis .

  • For complex phenotypes, employ multivariate statistical methods that can capture relationships between multiple dependent variables.

The interactive approach to experimental design using spreadsheets provides a practical framework for iteratively improving statistical models based on experimental outcomes .

How can researchers determine if observed phenotypes are directly related to ExeL function?

To establish a direct link between observed phenotypes and ExeL function, researchers should:

  • Perform complementation studies: Introduce wild-type ExeL into mutant strains to verify phenotype restoration.

  • Create targeted mutations: Generate specific mutations that affect different aspects of ExeL function rather than complete gene knockouts.

  • Assess multiple phenotypes: Examine various aspects of T2SS function, similar to studies of secretin assembly that assessed both membrane integrity and toxin secretion .

  • Compare with related systems: Draw parallels with better-characterized T2SS components, such as the dual-factor assembly system for the secretin in V. vulnificus that requires both the EpsAB complex and the pilotin EpsS .

  • Isolate direct effects: Design experiments that can distinguish direct effects of ExeL dysfunction from indirect consequences or compensatory mechanisms.

By applying these approaches, researchers can establish causality between ExeL function and observed phenotypes with greater confidence.

How does ExeL function compare across different bacterial species with T2SS?

Comparative analysis of ExeL across bacterial species should consider the diversity of T2SS assembly mechanisms. For example, the secretin components show distinct assembly pathways:

  • In V. vulnificus, secretin assembly requires the coordinated activity of both the accessory complex EpsAB and the pilotin EpsS for full assembly and T2SS function .

  • In contrast, A. hydrophila's ExeD secretin assembly appears to be pilotin-independent, as mutations in the S-domain (typically the site of pilotin interactions) have little effect on assembly or function .

These differences highlight the evolutionary diversity of T2SS assembly mechanisms. Similar variation likely exists for ExeL function across species, requiring careful comparative analysis to identify conserved and species-specific aspects of its role.

What are the implications of ExeL dysfunction for bacterial pathogenesis?

While the search results don't specifically address ExeL dysfunction, studies of other T2SS components provide insight into potential implications:

  • Reduced virulence: Mutations in T2SS components like the secretin lead to significantly reduced intestinal colonization and milder disease in animal models .

  • Biofilm defects: T2SS mutations in E. coli result in arrested biofilm formation at the microcolony stage .

  • Compromised membrane integrity: Proper secretin assembly is essential for membrane integrity in V. vulnificus .

  • Impaired toxin secretion: Functional T2SS is required for the export of toxic proteins that contribute to bacterial virulence .

How might structural information about ExeL inform the development of targeted antimicrobial strategies?

Structural insights into T2SS components like ExeL could inform novel antimicrobial approaches:

  • Identification of critical domains: Detailed structural analysis can reveal domains essential for protein-protein interactions within the T2SS complex, similar to the signature motif identified in pilotin-dependent secretins .

  • Structure-guided inhibitor design: Targeting specific structural features of ExeL that are essential for T2SS assembly or function.

  • Cross-species conservation analysis: Identifying highly conserved structural elements across different bacterial pathogens to develop broad-spectrum inhibitors.

  • Assembly interference: Designing molecules that specifically disrupt the assembly pathway of the T2SS, similar to how mutations in EpsAB or EpsS affect secretin assembly in V. vulnificus .

Since secretins are essential outer membrane channels present in various secretion systems, structural and functional insights into T2SS components like ExeL provide a basis for understanding key assembly steps across this vast family of proteins .

What emerging technologies could advance our understanding of ExeL function?

Several emerging technologies hold promise for advancing ExeL research:

  • High-resolution cryo-electron tomography: To visualize the intact T2SS within bacterial membranes, building on the success of cryo-EM for secretin structures .

  • Integrative structural biology approaches: Combining multiple techniques (X-ray crystallography, cryo-EM, mass spectrometry) to build comprehensive structural models of T2SS complexes.

  • Advanced protein engineering methods: Creating functional tags and sensors to monitor ExeL dynamics in real-time within living cells.

  • Machine learning-enhanced experimental design: Building on AED principles to optimize experimental conditions for ExeL studies .

  • Single-molecule tracking techniques: To monitor the dynamics of individual ExeL molecules during T2SS assembly and function.

These technologies could provide unprecedented insights into how ExeL contributes to T2SS assembly, stability, and function.

What experimental systems best model the in vivo function of ExeL in T2SS?

Optimal experimental systems for studying ExeL should balance physiological relevance with experimental tractability:

  • Native bacterial hosts: Studying ExeL in its natural context in A. hydrophila provides the most relevant physiological environment but may present technical challenges.

  • Heterologous expression systems: Using well-characterized bacterial hosts like E. coli for controlled expression and manipulation of ExeL.

  • Reconstituted membrane systems: Building minimal T2SS complexes in artificial membrane environments to study specific aspects of ExeL function.

  • Animal infection models: Assessing the consequences of ExeL mutations on bacterial virulence in relevant animal models, similar to the rabbit model used for REPEC studies .

  • Cell culture infection models: Examining the impact of ExeL function on host-pathogen interactions in controlled cell culture systems.

Each system offers distinct advantages, and a comprehensive understanding of ExeL will likely require integration of results across multiple experimental platforms.

How can computational approaches enhance ExeL research?

Computational methods can significantly advance ExeL research through:

  • Molecular dynamics simulations: Modeling the structural dynamics of ExeL and its interactions within the T2SS complex.

  • Homology modeling: Predicting ExeL structure based on related proteins with known structures.

  • Predictive algorithms for experimental design: Extending AED principles to optimize conditions for ExeL expression, purification, and functional studies .

  • Network analysis: Mapping the protein-protein interaction network of ExeL within the T2SS and broader cellular context.

  • Evolutionary analysis: Tracing the conservation and diversification of ExeL across bacterial species to identify functionally critical regions.

These computational approaches can guide experimental design, help interpret experimental results, and generate testable hypotheses about ExeL function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.