Recombinant Type II secretion system protein L (outL)

Shipped with Ice Packs
In Stock

Description

Definition and Role in the T2SS

OutL is an inner membrane protein integral to the T2SS architecture. It forms part of the inner membrane platform, a multi-protein complex that bridges cytoplasmic ATPases, periplasmic pseudopilus components, and outer membrane secretins . Key roles include:

  • Structural scaffolding: Stabilizes interactions between inner membrane components (e.g., GspC, GspF, GspM) .

  • Signal transduction: Mediates communication between the ATPase (GspE) and the pseudopilus .

  • Substrate recognition: Participates in docking secreted proteins to the secretion channel .

In recombinant systems, OutL is expressed in Escherichia coli or other hosts for structural and functional studies, enabling detailed biochemical characterization .

Functional Mechanisms

OutL operates through two primary mechanisms:

  1. ATPase Coordination: The cytoplasmic domain of OutL recruits GspE, ensuring ATP hydrolysis is coupled to pseudopilus assembly .

  2. Pseudopilus Dynamics: OutL stabilizes the pseudopilus base, enabling piston-like movements that push substrates through the secretin pore .

Key Functional Mutations

  • ΔOutL mutants: Abolish secretion in Legionella pneumophila and Vibrio cholerae, impairing intracellular survival and biofilm formation .

  • C-terminal truncations: Disrupt interactions with pseudopilins, halting substrate transport .

Recombinant Production and Applications

Recombinant OutL is generated for:

  • Crystallography: Soluble domains (e.g., periplasmic regions) are expressed with His-tags in E. coli BL21(DE3) and purified via Ni-NTA chromatography .

  • Interaction assays: Co-purification studies with GspE or pseudopilins validate binding partners .

Expression Systems for Recombinant OutL

SystemYield (mg/L)Purity (%)Functional Activity
E. coli BL21(DE3)15–20≥95ATPase binding
Pseudomonas putida8–1090Secretion rescue

Role in Pathogenesis

OutL is essential for virulence in multiple pathogens:

  • In Legionella pneumophila, LspL mutants fail to secrete aminopeptidases (LapA, LapB), impairing macrophage and amoebal infection .

  • In Vibrio vulnificus, EpsL deletion reduces secretion of cytolytic toxins, attenuating mortality in murine models .

Biofilm Regulation

  • OutL-dependent secretion of matrix proteins (e.g., RbmC in V. cholerae) is critical for biofilm architecture .

  • OutL mutants exhibit 70% reduced biofilm biomass in Aeromonas hydrophila .

Evolutionary Conservation

OutL homologs are present in 85% of T2SS-encoding bacteria, with conserved residues in ATPase-binding regions . Eukaryotic homologs in jakobids and heteroloboseans suggest ancient evolutionary origins .

Challenges and Future Directions

  • Structural flexibility: Full-length OutL resists crystallization due to transmembrane dynamics . Cryo-EM studies on intact T2SS complexes are ongoing .

  • Therapeutic targeting: Small-molecule inhibitors of OutL-ATPase interactions are under exploration to block bacterial secretion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
outL; Type II secretion system protein L; T2SS protein L; General secretion pathway protein L; Pectic enzymes secretion protein OutL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi)
Target Names
outL
Target Protein Sequence
MSKAENTSGKQQLILRLSADTSDSLEWLIWSVSRHQTLTTGSGTLESLQAVLADYPVISA RVLVPSTDVTFHTLSLPRQSRRQLLQAIPFMLEEQVASDIDQLHFAVMDMHGDNATVAVV QKSRLRAWLNQCETLGVPVETVVPDVMALPRADSAWSAISHRNLWLFRLDSGIGMAAEEN WYQSLLAFQPLPAVHCYSPVPASALTWQPQPVTDLLTLAAQVNLSMSMDLRQGEYAPVKP WKQALLPWRNVLIALSAWLLLVLGESVWTHYQWYRQADYWRQESVRVYRKLFPDEKQVVN PRAQMQRHLQEVRAGVSGFALTEQMNRLQQLVAQNEGVSLQSLSYDRSRDELRLSLRATS YAQMEQFRQQAQAYFQIPPGEMKQEKDHVEGQLTLRSQP
Uniprot No.

Target Background

Function

An inner membrane component of the type II secretion system, essential for the energy-dependent secretion of extracellular factors (e.g., proteases and toxins) from the periplasm. It plays a crucial role in complex assembly, recruiting OutM to form a stable inner membrane complex. This interaction links the cytoplasmic energy-providing OutE protein to the remaining T2SS machinery.

Protein Families
GSP L family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How should I design experiments to study OutL function in bacterial systems?

When designing experiments to study OutL function, you should apply rigorous experimental design principles to ensure conclusive and specific results. Begin with a testable hypothesis statement about OutL function, clearly define your independent variables (what you'll manipulate) and dependent variables (what you'll measure) . For investigating OutL, typical approaches include:

  • Gene knockout/complementation studies: Generate outL null mutants and complement with wild-type or mutated versions to assess functional effects.

  • Protein interaction analysis: Use co-immunoprecipitation, bacterial two-hybrid systems, or crosslinking approaches to identify binding partners.

  • Secretion assays: Measure the secretion efficiency of known T2SS substrates when OutL is mutated or absent.

  • Structural studies: Employ cryo-electron microscopy to visualize OutL in the context of the assembled T2SS.

All experiments should include appropriate controls and be designed to distinguish between direct and indirect effects of OutL manipulation . For studying dynamic processes like T2SS assembly, consider time-course experiments to capture the temporal sequence of events.

What expression systems are most effective for producing recombinant OutL protein?

For recombinant OutL production, several expression systems can be employed, but the choice depends on experimental goals and protein characteristics. Bacterial expression systems, particularly E. coli, are commonly used for initial attempts at recombinant membrane protein production1. When expressing OutL, consider the following approaches:

  • Construct design: Include appropriate affinity tags (His, GST, SUMO) to facilitate purification and potentially enhance solubility1.

  • Host strain selection: BL21(DE3) derivatives engineered for membrane protein expression often provide better yields.

  • Expression conditions: Use lower temperatures (16-25°C) and reduced inducer concentrations to slow expression rate and improve folding.

  • Fusion partners: Consider fusion with solubility-enhancing partners like SUMO or MBP if protein solubility is problematic1.

Always verify your construct by sequencing before expression attempts, as hidden mutations can significantly impact protein expression and function1. If initial expression attempts fail, systematic troubleshooting is necessary, beginning with protein detection via Western blotting to determine if the issue relates to expression, solubility, or purification1.

What are the molecular interactions between OutL and other T2SS components, and how can they be experimentally determined?

OutL forms essential molecular interactions with multiple T2SS components, notably organizing into a hexameric complex with the PulE ATPase and PulM . These interactions are central to the assembly and function of the secretion system. To experimentally investigate these interactions:

  • Structural approaches: High-resolution cryo-electron microscopy has proven effective in determining the spatial relationships between OutL and other components, as demonstrated in the K. pneumoniae T2SS structure . This approach revealed how OutL contributes to the flexible hexameric hub formation.

  • Biochemical interaction mapping: Site-directed crosslinking combined with mass spectrometry can identify specific residues involved in protein-protein contacts.

  • Mutagenesis studies: Systematic alanine scanning mutagenesis of predicted interaction interfaces can identify critical residues.

  • In vivo interaction systems: Bacterial two-hybrid or split-protein complementation assays can verify interactions in a cellular context.

When designing these experiments, it's crucial to account for the dynamic nature of the T2SS and the potential for transient interactions during the secretion cycle. The conformational flexibility observed in the hexameric hub containing OutL suggests that capturing different functional states may require specialized approaches .

How does the stoichiometry of OutL influence T2SS assembly and function?

The stoichiometric ratio of OutL relative to other components is critical for proper T2SS assembly and function. Experimental data from K. pneumoniae has established that the inner membrane assembly platform components maintain a precise ratio of PulC:PulE:PulL:PulM:PulN at 2:1:1:1:1 . This stoichiometry has several functional implications:

  • Symmetry mismatch resolution: The T2SS exhibits a fascinating architectural feature where the outer membrane secretin complex (15-fold symmetry) must communicate with the inner membrane assembly platform (6-fold symmetry). This symmetry mismatch is overcome through flexible PulC linkers spanning the periplasm . The hexameric organization involving OutL is central to this symmetry resolution.

  • Energy transduction: The stoichiometric arrangement of OutL within the hexameric hub with PulE ATPase suggests its role in coupling ATP hydrolysis to mechanical work.

To experimentally investigate stoichiometry effects:

  • Employ quantitative proteomic approaches to assess component ratios in native systems

  • Engineer systems with altered stoichiometry through controlled expression

  • Use single-molecule imaging techniques to capture assembly dynamics

The modular nature of the T2SS architecture, with OutL as a key component, allows for flexibility during the secretion process while maintaining essential structural integrity .

What are the major challenges in purifying functional recombinant OutL, and what strategies can overcome them?

Purifying functional recombinant OutL presents several challenges typical of membrane-associated proteins. These challenges and potential solutions include:

  • Solubility issues: OutL, as a component of the inner membrane assembly platform, contains hydrophobic regions that can lead to aggregation. To address this:

    • Use fusion partners like SUMO, GST, or MBP to enhance solubility1

    • Test multiple detergents and amphipols for membrane protein extraction

    • Consider nanodiscs or styrene maleic acid copolymer lipid particles (SMALPs) for native-like membrane environments

  • Conformational stability: OutL functions within a multi-protein complex and may be unstable in isolation.

    • Co-expression with interacting partners (e.g., PulE and PulM) may improve stability

    • Identify minimal functional domains that can be expressed more robustly

    • Optimize buffer conditions including pH, salt concentration, and additives1

  • Functional verification: Ensuring the purified protein retains native activity.

    • Develop in vitro assays for OutL function, such as ATPase activity measurements

    • Use structural techniques like circular dichroism to verify proper folding

    • Assess interaction capabilities with known binding partners

When troubleshooting recombinant OutL expression and purification, systematic approaches are essential, starting with expression verification via Western blotting before addressing solubility and purification challenges1. Additionally, reviewing published protocols for similar T2SS components can provide valuable insights into successful purification strategies.

How do mutations in OutL affect T2SS function in different bacterial pathogens?

Mutations in OutL can profoundly impact T2SS function across different bacterial pathogens, providing insights into its mechanistic contributions. The effects of OutL mutations have been studied in several systems:

  • Impact on secretion efficiency: In Legionella pneumophila, disruption of the T2SS components (including OutL homologs) impairs the secretion of virulence factors and aminopeptidases like LapA and LapB . This leads to reduced growth in iron-rich media and compromised survival in tap water at low temperatures .

  • Effects on pathogenesis: T2SS mutants in L. pneumophila show attenuated virulence in various infection models, including human macrophages, Hartmannella vermiformis, and murine pneumonia models . This suggests OutL's indirect but essential contribution to pathogenesis.

  • Structural implications: Based on cryo-EM studies of the K. pneumoniae T2SS, mutations in the interface regions where OutL interacts with PulE and PulM would be expected to disrupt the hexameric hub formation and compromise the entire secretion apparatus .

To experimentally assess OutL mutations:

  • Generate site-directed mutations in conserved residues or domain interfaces

  • Assay for type II-dependent secretion of known substrates

  • Monitor T2SS assembly using fluorescently tagged components

  • Assess pathogen-host interactions using appropriate infection models

When designing such experiments, it's important to distinguish between mutations that directly affect OutL function versus those that simply disrupt protein folding or stability.

What role does OutL play in the dynamic assembly process of the T2SS?

OutL plays a crucial role in the dynamic assembly process of the T2SS, particularly in establishing the inner membrane platform that powers secretion. Based on structural and functional analyses:

  • Hexameric hub formation: OutL combines with PulE ATPase and PulM to form a flexible hexameric hub at the inner membrane, which serves as a central assembly point for the rest of the inner membrane complex .

  • Energy coupling: The association of OutL with the PulE ATPase suggests it may function in coupling ATP hydrolysis to mechanical movement required for pseudopilus assembly and substrate transport.

  • Symmetry coordination: The T2SS exhibits a remarkable architectural feature where the 15-fold symmetry of the outer membrane secretin must interface with the 6-fold symmetry of the inner membrane complex. OutL, as part of the hexameric hub, contributes to this symmetry mismatch resolution that is bridged by PulC linkers .

To experimentally study these dynamic processes:

  • Employ fluorescence recovery after photobleaching (FRAP) to measure component exchange rates

  • Use single-particle tracking to monitor assembly dynamics in live cells

  • Develop in vitro reconstitution systems to study assembly under controlled conditions

  • Apply hydrogen-deuterium exchange mass spectrometry to identify regions with conformational flexibility

The highly dynamic and modular nature of the T2SS architecture, with OutL as a key component, has significant implications for understanding pseudopilus assembly and substrate loading mechanisms .

What experimental approaches can distinguish between direct and indirect effects of OutL manipulation in T2SS studies?

Distinguishing between direct and indirect effects of OutL manipulation requires carefully designed experimental approaches that isolate specific interactions and functions. Effective strategies include:

When analyzing results, apply rigorous statistical methods appropriate for experimental design type, and ensure proper controls are implemented at each step . This approach follows true experimental research design principles, allowing for causal inferences about OutL function .

How can structural biology approaches be optimized for studying OutL in the context of the complete T2SS?

Structural biology approaches for studying OutL within the complete T2SS require specialized techniques due to the size (~2.4 MDa), membrane association, and dynamic nature of the complex. Optimization strategies include:

  • Cryo-electron microscopy optimization:

    • Sample preparation: Use gentle detergent solubilization or nanodiscs to maintain native membrane environment

    • Data collection: Employ motion correction and energy filtering for improved resolution

    • Image processing: Apply focused classification to resolve heterogeneous states of the dynamic complex

  • Integrative structural approaches:

    • Combine high-resolution structures of individual domains with lower-resolution maps of the complete complex

    • Use crosslinking mass spectrometry to identify interaction interfaces

    • Apply molecular dynamics simulations to model dynamic behaviors

  • In situ structural determination:

    • Employ cryo-electron tomography to visualize T2SS complexes within bacterial cells

    • Use correlative light and electron microscopy to connect structural observations with functional states

  • Dynamic structural studies:

    • Trap different functional states using ATP analogs or substrate interactions

    • Apply time-resolved cryo-EM to capture assembly intermediates

What bioinformatic approaches are most effective for analyzing OutL evolution and conservation across bacterial species?

Bioinformatic analysis of OutL evolution and conservation requires specialized approaches due to its sequence divergence across species while maintaining functional conservation. Effective strategies include:

  • Sequence analysis tools:

    • Position-Specific Iterative BLAST (PSI-BLAST) for sensitive detection of distant homologs

    • Hidden Markov Model (HMM) profiles to capture sequence patterns in OutL families

    • Multiple sequence alignment using structure-aware algorithms like PROMALS3D

  • Structural bioinformatics:

    • Structure-based sequence alignments to identify functionally important regions despite sequence divergence

    • Homology modeling based on solved structures like the K. pneumophila PulL

    • Coevolution analysis to predict residue contacts important for function

  • Comparative genomics:

    • Analysis of gene neighborhood conservation to identify functional associations

    • Correlation of OutL sequence features with host range or substrate specificities

    • Identification of horizontal gene transfer events in T2SS evolution

  • Classification approaches:

    • Phylogenetic analyses to reconstruct evolutionary relationships between OutL variants

    • Machine learning approaches to classify OutL sequences into functional subtypes

When implementing these approaches, it's important to consider the specific bacterial systems being studied, such as Legionella pneumophila and Klebsiella pneumoniae, which represent important model systems for T2SS research . The conservation patterns detected can guide experimental design by highlighting residues and regions likely to be functionally significant across diverse species.

What are common pitfalls in recombinant OutL expression and how can they be addressed?

Recombinant OutL expression presents several challenges typical of membrane-associated proteins. Common pitfalls and their solutions include:

  • Low expression levels:

    • Problem: Toxic effects due to membrane protein overexpression

    • Solutions: Use tightly controlled inducible promoters, lower induction temperature (16-25°C), reduce inducer concentration, try C41/C43 E. coli strains designed for membrane protein expression1

  • Protein insolubility/aggregation:

    • Problem: Formation of inclusion bodies due to hydrophobic regions

    • Solutions: Add solubility-enhancing fusion partners (SUMO, MBP, GST), optimize buffer conditions (pH, salt concentration), test different detergents for extraction1

  • Degradation:

    • Problem: Unstable protein subject to proteolysis

    • Solutions: Use protease-deficient host strains, add protease inhibitors, optimize purification speed and conditions

  • Improper folding:

    • Problem: Non-native conformation affecting function

    • Solutions: Co-express with chaperones, try periplasmic expression strategies, consider expression in alternative hosts

  • Post-translational modifications:

    • Problem: Missing modifications required for function

    • Solutions: Select expression systems capable of performing relevant modifications

When troubleshooting expression issues, it's essential to first verify expression using Western blotting before assuming expression failure, as this helps diagnose whether problems lie with expression, solubility, or purification steps1. Additionally, always check your construct for unwanted mutations that could impact expression or function1.

Expression SystemAdvantagesDisadvantagesBest For
E. coli BL21(DE3)High yields, simpleLimited post-translational modificationsInitial screening
E. coli C41/C43Better for membrane proteinsLower yieldsOutL expression
Cell-free systemsAvoids toxicity issuesExpensive, limited scaleDifficult-to-express variants
Insect cellsBetter folding, some modificationsMore complex, expensiveFull-length OutL

How can I optimize biochemical assays to measure OutL activity and interactions?

Optimizing biochemical assays for OutL activity and interactions requires careful consideration of protein properties and the molecular context in which it functions. Recommended approaches include:

  • Co-immunoprecipitation optimization:

    • Use reversible crosslinking to capture transient interactions

    • Optimize detergent type and concentration for membrane protein extraction

    • Include appropriate controls (non-specific IgG, reverse co-IP)

    • Consider native elution conditions to maintain complex integrity

  • ATPase activity assays (for OutL-PulE complex):

    • Optimize buffer components (metal ions, pH, salt)

    • Test multiple nucleotide concentrations

    • Use real-time assays (e.g., coupled enzyme systems) for kinetic analysis

    • Include controls to distinguish OutL contribution to activity

  • Binding assays:

    • Surface plasmon resonance (SPR) with controlled OutL orientation

    • Microscale thermophoresis for solution-based measurements

    • Fluorescence-based approaches (FRET, fluorescence polarization)

    • Consider lipid environments for membrane-associated interactions

  • Structural stability assays:

    • Differential scanning fluorimetry to optimize buffer conditions

    • Limited proteolysis to identify stable domains

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

When designing these assays, it's crucial to include appropriate positive and negative controls and to validate findings using multiple independent methods. For protein-protein interactions, specifically verify that observed interactions occur at physiologically relevant concentrations and are specific rather than due to non-specific aggregation or hydrophobic effects.

What strategies can improve the functional reconstitution of OutL in membrane mimetics?

Functional reconstitution of OutL in membrane mimetics is crucial for biochemical and structural studies of this inner membrane T2SS component. Optimal strategies include:

  • Selection of appropriate membrane mimetics:

    • Detergent screening: Start with mild detergents (DDM, LMNG) and optimize concentration

    • Amphipols: Consider A8-35 or PMAL for increased stability after detergent removal

    • Nanodiscs: MSP-based or polymer-based (SMALPs) for native-like lipid bilayer environment

    • Liposomes: For functional assays requiring closed compartments

  • Optimization of lipid composition:

    • Test lipid mixtures mimicking bacterial inner membrane (PE, PG, cardiolipin)

    • Optimize lipid-to-protein ratio for stability and function

    • Consider adding specific lipids that might be required for function

  • Reconstitution protocols:

    • Gentle removal of detergent (dialysis, Bio-Beads, cyclodextrin)

    • Temperature control during reconstitution process

    • Step-wise assembly with interaction partners

  • Functional validation:

    • Assess protein orientation in membrane mimetics

    • Verify maintenance of interaction capabilities with T2SS partners

    • Develop assays to measure specific activities in the reconstituted system

Successful reconstitution should maintain the native hexameric architecture observed for the OutL-containing inner membrane complex . When reconstituting with partner proteins, consider the established stoichiometric ratios (e.g., the 2:1:1:1:1 ratio of PulC:PulE:PulL:PulM:PulN) to ensure proper complex assembly.

How can we apply knowledge of OutL structure and function to develop novel antimicrobial strategies?

Understanding OutL structure and function offers promising opportunities for developing targeted antimicrobial strategies, particularly against pathogens that rely on T2SS for virulence. Potential approaches include:

  • Targeted inhibitor development:

    • Design small molecules targeting the OutL-PulE interface to disrupt energy coupling

    • Develop peptide inhibitors mimicking critical interaction interfaces

    • Screen for compounds that lock OutL in non-functional conformations

  • Virulence attenuation strategies:

    • Target OutL to impair secretion of specific virulence factors

    • Design antimicrobials that selectively inhibit T2SS without affecting growth, reducing selection pressure

    • Combine with antibiotic therapy for enhanced clearance of attenuated pathogens

  • Vaccine development:

    • Explore exposed epitopes of the T2SS as vaccine targets

    • Consider inactivated T2SS components as part of subunit vaccines

    • Develop attenuated strains with modified OutL for live vaccines

  • Diagnostic applications:

    • Develop sensors for T2SS activity as early indicators of infection

    • Create diagnostic tools targeting secreted virulence factors

The critical role of T2SS in multiple human pathogens, including Legionella pneumophila, Acinetobacter baumannii, Chlamydia trachomatis, Escherichia coli, and Vibrio cholerae, underscores the broad potential impact of such approaches . The fact that T2SS disruption affects survival in different environmental conditions also suggests potential applications in controlling environmental reservoirs of these pathogens .

What experimental approaches can reveal the dynamic conformational changes in OutL during the secretion cycle?

Investigating the dynamic conformational changes in OutL during the secretion cycle requires specialized techniques that can capture transient states and molecular movements. Effective approaches include:

  • Single-molecule techniques:

    • Single-molecule FRET to track distance changes between labeled domains

    • High-speed atomic force microscopy to visualize conformational dynamics

    • Single-molecule tracking in live cells to monitor diffusion and assembly

  • Time-resolved structural methods:

    • Time-resolved cryo-EM with millisecond mixing devices

    • Temperature-jump or rapid dilution techniques coupled with structural analysis

    • Hydrogen-deuterium exchange mass spectrometry at different stages of the cycle

  • Site-specific probes:

    • Site-directed spin labeling for electron paramagnetic resonance

    • Incorporation of environment-sensitive fluorophores at key positions

    • Disulfide crosslinking to trap specific conformational states

  • Computational approaches:

    • Molecular dynamics simulations to model conformational transitions

    • Normal mode analysis to identify potential movement patterns

    • Markov state modeling to map conformational landscapes

The flexible nature of the hexameric hub containing OutL, as revealed by cryo-EM studies , suggests substantial conformational dynamics during the secretion cycle. These movements likely couple ATPase activity to mechanical force generation required for substrate translocation. When designing experiments to capture these changes, it's important to consider the natural timescale of the secretion process and to develop methods that can synchronize the system to enrich for specific functional states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.