Recombinant Type II secretion system protein L (pulL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pulL; Type II secretion system protein L; T2SS protein L; General secretion pathway protein L; Pullulanase secretion protein PulL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Names
pulL
Target Protein Sequence
MNNHHTSSAAVLIIRLNPDAATAIWRLAAPGDTAQTGEWHPDAGDPTLSLLAQRHPAWVL VPASDCAFHRVALPAGARRRPQQALAFLLEEQLATEVEESHFALLHQHKTDCAVAVVGRG KMRAWQAWCDSLGLSVLALTPDVLALPHSPTGWSAVRCGEQWLFRCDTWGGMAVETVWLD QLLTHWQDLAPIACYSPPPDIAAPWQPLPAQDLLQLAAANPDARRICLRQGDFAAKRRRQ PTPRRWRPVIVAALALLLLWSSNCLHDHLMLGQQADAAVQASRDFYRQWFQTEKNVVNPR LQMQQHLRQMKNAGARPALISRLGALQQIIDDTPGIRLRTLSFDAARNALQLEISAVSSQ ALEQFSQRARARFRVQTGEMKPRADGIEGRLTLEGNDA
Uniprot No.

Target Background

Function

Recombinant PulL is an inner membrane component of the type II secretion system (T2SS). It is crucial for the energy-dependent secretion of extracellular factors, such as proteases and toxins, from the periplasm. PulL plays a vital role in the complex assembly of the T2SS, recruiting PulM to form a stable inner membrane complex. This interaction links the cytoplasmic energy-providing PulE protein to the remaining T2SS machinery.

Protein Families
GSP L family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Type II Secretion System and what role does protein L play in it?

The Type II Secretion System (T2SS) is a complex macromolecular machinery used by many Gram-negative bacteria to secrete specific proteins from the periplasm to the extracellular environment. The T2SS shares structural and functional similarities with type IV pilus (T4P) biogenesis systems and archaeal flagella, particularly in their ability to assemble thin, flexible filaments composed of small, initially inner membrane-localized proteins called "pilins" .

Protein L (PulL) is a crucial assembly factor of the T2SS that works in conjunction with other components such as PulF and PulM to facilitate the assembly of pseudopili. These pseudopili are essential filamentous structures that extend through the periplasm and are thought to act as a piston to drive substrate secretion . In Legionella pneumophila, the lspLM locus is one of the gene clusters predicted to promote secretion, highlighting the conserved nature of PulL across different bacterial species .

How is PulL evolutionarily conserved across bacterial species?

PulL belongs to a family of highly conserved proteins found in T2SS of various Gram-negative bacteria. While specific sequence information about PulL was limited in the search results, the T2SS components as a whole show significant conservation across bacterial species. The functional importance of these proteins is highlighted by the fact that T2SS of Klebsiella oxytoca and Legionella pneumophila share similar structural and functional properties despite their evolutionary distance .

The conservation of key residues involved in hydrophobic and electrostatic interactions within the major pseudopilin family suggests that the structural model derived for PulG pilus assembly likely applies to PulL and other T2SS components across different bacterial species .

What are the basic structural characteristics of PulL?

Based on the available information, PulL appears to be an inner membrane component of the T2SS assembly apparatus. While the search results don't provide the specific structural details of PulL itself, we can infer from related T2SS components that it likely contains transmembrane domains that anchor it to the inner membrane, and cytoplasmic domains that interact with other T2SS components .

The protein likely participates in crucial protein-protein interactions with other assembly factors like PulF and PulM, which together facilitate the assembly of the pseudopilus structure. This structure contains a narrow hydrophobic central cavity and is stabilized by numerous specific interactions between neighboring protomers, including both hydrophobic and electrostatic interactions .

What phenotypes are associated with pulL mutations in bacteria?

While the search results don't specifically describe pulL mutation phenotypes, we can infer from studies on other T2SS components that mutations in pulL would likely impair protein secretion and affect bacterial virulence. In Legionella pneumophila, mutations in the type II secretion system genes (lsp genes, which include lspLM) result in defects in secretion of multiple enzymes including protease, RNase, lipase, phospholipase A, phospholipase C, lysophospholipase A, and various acid phosphatase activities .

Additionally, T2SS mutants demonstrate reduced ability to infect both amoebae (natural environmental hosts) and human macrophages, as well as impaired growth in the lungs of mice in experimental infection models . Given PulL's role as an assembly factor in the T2SS, similar phenotypes would be expected for pulL mutants.

How do PulL-protein interactions contribute to T2SS assembly and function?

PulL appears to form a crucial part of the inner membrane assembly complex that facilitates pseudopilus biogenesis. Based on the structural models of the T2SS, PulL likely interacts with multiple proteins, including other assembly factors like PulF and PulM .

In the PulG pilus assembly mechanism proposed by Campos et al., hydrophobic patches on protomers exposed to the aqueous environment could either contribute to direct contacts between subunits or be masked by assembly factors such as "PulF/L/M" . This suggests that PulL may play a role in stabilizing the nascent pseudopilus during assembly by interacting with newly incorporated subunits.

The assembly process involves a series of specific interactions between neighboring protomers, with each protomer interacting directly with three upper and three lower protomers through both hydrophobic and electrostatic interactions . PulL may facilitate these interactions, potentially by positioning pseudopilin subunits correctly for incorporation into the growing pilus.

What methodological approaches are optimal for expressing and purifying recombinant PulL?

For successful expression and purification of recombinant PulL, researchers should consider the following methodology:

  • Expression System Selection: Since PulL is likely a membrane protein, expression systems that handle membrane proteins well are recommended. E. coli strains such as C43(DE3) or C41(DE3), which are engineered for membrane protein expression, would be suitable.

  • Vector Design: Include appropriate affinity tags (His6 or Strep-tag) for purification, but position them carefully to avoid interfering with protein folding or function. Including a cleavable tag may be beneficial for subsequent functional studies.

  • Solubilization Strategy: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to extract PulL from membranes while maintaining its native conformation.

  • Purification Protocol:

    • Utilize affinity chromatography (Ni-NTA for His-tagged constructs)

    • Follow with size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography as a polishing step

  • Quality Control: Verify protein purity using SDS-PAGE and Western blotting, and assess protein folding using circular dichroism or limited proteolysis.

For structural studies, reconstitution into nanodiscs or amphipols may provide a more native-like environment than detergent micelles and enhance protein stability.

How does temperature regulation impact pulL expression and T2SS function?

Temperature regulation appears to play a significant role in T2SS gene expression and function. In Legionella pneumophila, transcription of pilD, which encodes the prepilin peptidase essential for both type IV pilus biogenesis and type II protein secretion, increases progressively as growth temperature decreases from 37°C to 30°C, 25°C, and 17°C .

Given that PulL is part of the T2SS machinery that depends on PilD for function, it's reasonable to infer that pulL expression might also be subject to temperature-dependent regulation. The finding that Legionella strains with mutations in type II secretion genes (lsp genes) have dramatically reduced ability to grow in broth and form colonies on agar at lower temperatures suggests that the entire T2SS, including PulL, is crucial for bacterial adaptation to colder environments .

This temperature-dependent regulation of T2SS may represent an adaptive response that allows bacteria to adjust their secretory capacity based on environmental conditions. For researchers working with recombinant PulL, this suggests that expression conditions should be carefully optimized with respect to temperature.

What techniques can be used to study PulL-mediated protein-protein interactions in the T2SS?

Several advanced techniques can be employed to study the protein-protein interactions involving PulL in the T2SS:

  • Bacterial Two-Hybrid (B2H) Assays: Useful for initial screening of potential interaction partners by fusing PulL and candidate partners to complementary fragments of a reporter protein.

  • Co-immunoprecipitation (Co-IP): Can be used to pull down PulL along with its interaction partners from bacterial lysates, followed by mass spectrometry identification.

  • Cross-linking Coupled with Mass Spectrometry: Chemical cross-linkers can capture transient interactions, and mass spectrometry can identify the cross-linked peptides, providing detailed information about interaction interfaces.

  • Surface Plasmon Resonance (SPR): Allows quantitative measurement of binding affinities between PulL and other T2SS components under various conditions.

  • Fluorescence Resonance Energy Transfer (FRET): Can be used to study interactions in live cells by tagging PulL and potential partners with appropriate fluorophores.

  • Cysteine Scanning and Disulfide Cross-linking: This approach, which was successfully used for PulG pilus studies, involves introducing cysteine residues at specific positions followed by oxidation-induced disulfide bond formation between adjacent subunits. Double-cysteine substitutions in transmembrane segments can lead to position-specific cross-linking that provides valuable information about residue distances and orientation in assembled complexes .

  • Cryo-Electron Microscopy (Cryo-EM): For structural characterization of PulL within the context of the assembled T2SS machinery.

How do mutations in conserved residues of PulL affect T2SS assembly and bacterial virulence?

While specific information about PulL mutations was not provided in the search results, insights can be drawn from studies of other T2SS components. In the PulG pilus, two intermolecular salt bridges were found to be crucial for function, as demonstrated by single and complementary charge inversions .

For PulL, researchers might consider the following approach to study the impact of mutations:

  • Identification of Conserved Residues: Perform sequence alignment of PulL homologs across bacterial species to identify highly conserved residues.

  • Targeted Mutagenesis: Create point mutations in these conserved residues, particularly those predicted to be involved in protein-protein interactions.

  • Functional Assays: Assess the impact of mutations on:

    • T2SS-dependent enzyme secretion (protease, lipase, phospholipase activities)

    • Bacterial growth under various conditions, especially at lower temperatures

    • Intracellular replication in host cells (amoebae and macrophages)

    • Virulence in animal models of infection

  • Structural Analysis: Determine how mutations affect the assembly of the T2SS machinery using techniques such as electron microscopy.

Mutations in the T2SS have been shown to significantly impair bacterial virulence. In Legionella pneumophila, lsp mutants exhibit reduced ability to grow in the lungs of A/J mice compared to wild-type strains, as measured by competition assays . Similar approaches could be used to assess the impact of specific pulL mutations on bacterial virulence.

What are common challenges in recombinant PulL expression and how can they be addressed?

Recombinant expression of membrane proteins like PulL often presents several challenges:

  • Protein Toxicity: Overexpression of membrane proteins can be toxic to the host cells.

    • Solution: Use tightly regulated expression systems and lower induction levels. Consider using bacterial strains specifically designed for toxic protein expression (C43/C41).

  • Protein Misfolding and Aggregation: Membrane proteins often misfold when overexpressed.

    • Solution: Lower the expression temperature (16-20°C), use fusion partners that enhance solubility (MBP, SUMO), or co-express with chaperones.

  • Low Expression Yields: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the expression host, screen multiple expression conditions, and consider using stronger promoters or high cell density cultivation methods.

  • Difficulty in Extraction from Membranes: Finding the right detergent for solubilization can be challenging.

    • Solution: Screen a panel of detergents at various concentrations to identify optimal extraction conditions that maintain protein stability and function.

  • Protein Instability: Membrane proteins often become unstable once removed from the lipid bilayer.

    • Solution: Add lipids or specific stabilizing agents during purification, or consider reconstitution into nanodiscs or liposomes to provide a more native-like environment.

How can researchers effectively study the role of PulL in bacterial adaptation to different environmental temperatures?

Based on the evidence that T2SS function is critical for bacterial growth at lower temperatures , researchers can employ the following approaches to study PulL's role in temperature adaptation:

  • Comparative Expression Analysis:

    • Use qRT-PCR to measure pulL transcript levels across a temperature gradient (e.g., 17°C, 25°C, 30°C, and 37°C)

    • Create pulL::reporter fusions (e.g., pulL::lacZ) to monitor transcriptional activity in response to temperature shifts

  • Phenotypic Assays:

    • Compare growth kinetics of wild-type, pulL deletion mutants, and complemented strains at different temperatures

    • Assess colony morphology and biofilm formation across temperature ranges

    • Quantify T2SS-dependent enzyme activities in culture supernatants at various temperatures

  • Protein-Level Analysis:

    • Use Western blotting to quantify PulL protein levels at different temperatures

    • Perform pulse-chase experiments to determine if temperature affects PulL stability or turnover

    • Use fluorescently tagged PulL to monitor its localization and assembly into the T2SS complex at different temperatures

  • Structural Studies:

    • Investigate if temperature affects PulL conformation or its interactions with other T2SS components

    • Perform thermal stability assays (e.g., differential scanning fluorimetry) to determine if PulL has different stability profiles at different temperatures

  • In vivo Relevance:

    • Test the virulence of wild-type and pulL mutant strains in infection models maintained at different temperatures

    • For environmental bacteria, assess survival and competition in simulated natural conditions with temperature fluctuations

What controls should be included when studying PulL function in T2SS-dependent secretion assays?

When designing experiments to study PulL function in T2SS-dependent secretion, the following controls should be included:

  • Positive Controls:

    • Wild-type strain expressing fully functional T2SS

    • Complemented pulL mutant strains to confirm phenotype restoration

    • Purified enzymes as standards for activity assays

  • Negative Controls:

    • Complete T2SS knockout strain (e.g., deletion of essential components like lspDE)

    • Strains with mutations in other T2SS components to compare specificity of effects

    • Growth media alone to establish baseline readings for enzymatic assays

  • Specificity Controls:

    • Mutations in type IV pilus components to differentiate between pilus and T2SS functions

    • Strains with mutations in other secretion systems (e.g., dot/icm in L. pneumophila) to confirm specificity to T2SS

  • Technical Controls:

    • Cell lysis markers (e.g., cytoplasmic proteins) in culture supernatants to ensure observed enzyme activities are truly secreted and not due to cell lysis

    • Housekeeping gene expression for normalization in transcriptional studies

    • Loading controls for Western blot analysis of protein levels

  • Functional Validation:

    • Specific inhibitors of secreted enzymes to confirm the identity of measured activities

    • Site-directed mutants of PulL with predicted functional defects

    • Domain swapping experiments with homologous proteins from other species

How can researchers distinguish between direct and indirect effects of pulL mutations on the T2SS?

Distinguishing between direct and indirect effects of pulL mutations requires a multi-faceted approach:

  • Biochemical Interaction Studies:

    • Perform direct binding assays between purified PulL and other T2SS components

    • Use site-directed mutagenesis to disrupt specific interaction interfaces

    • Employ techniques like SPR or ITC to quantify binding affinities

  • Structural Analysis:

    • Create structural models of PulL within the T2SS complex

    • Use techniques like cryo-EM to visualize the assembled secretion machinery

    • Employ molecular dynamics simulations to predict the impact of specific mutations

  • Genetic Approaches:

    • Create suppressor mutations that can rescue pulL mutant phenotypes

    • Perform epistasis analysis with mutations in other T2SS components

    • Use allele-specific interactions to map functional relationships

  • Temporal Studies:

    • Examine the order of assembly of T2SS components in the presence of wild-type vs. mutant PulL

    • Use pulse-chase experiments to track the fate of newly synthesized T2SS substrates

    • Monitor the kinetics of pseudopilus assembly with techniques like fluorescence recovery after photobleaching (FRAP)

  • Selective Complementation:

    • Create chimeric proteins with domains from homologous proteins to identify functional regions

    • Use domain-specific antibodies to determine which regions of PulL are accessible in the assembled complex

    • Perform in trans complementation with specific PulL domains to rescue different aspects of mutant phenotypes

What statistical approaches are most appropriate for analyzing experimental data on PulL function?

The choice of statistical methods depends on the experimental design and data characteristics:

  • For Growth and Virulence Studies:

    • Two-way ANOVA to assess the effects of both genotype (wild-type vs. mutant) and environmental conditions (temperature, growth medium)

    • Survival analysis (Kaplan-Meier) for infection models

    • Competitive index calculations for mixed infection experiments

  • For Protein-Protein Interaction Studies:

    • Non-linear regression for binding curves (SPR, ITC data)

    • Correlation analyses for co-localization studies

    • Network analysis for complex interaction patterns

  • For Secretion Assays:

    • Multiple t-tests with correction for multiple comparisons when assessing multiple enzymatic activities

    • Repeated measures ANOVA for time-course experiments

    • Principal component analysis to identify patterns across multiple secreted factors

  • For Structural Studies:

    • Distance constraints analysis for cross-linking data

    • Goodness-of-fit tests for structural models

    • Cluster analysis for conformational ensembles

  • General Considerations:

    • Always include appropriate tests for normality before choosing parametric tests

    • Use non-parametric alternatives when data violate assumptions of normal distribution

    • Consider mixed-effects models when dealing with nested experimental designs

    • Implement Bayesian approaches for complex datasets with multiple sources of uncertainty

How can researchers integrate structural and functional data to build comprehensive models of PulL's role in the T2SS?

Integrating structural and functional data requires a systematic approach:

  • Data Collection and Curation:

    • Compile all available structural information on PulL and homologous proteins

    • Gather functional data from multiple experimental systems

    • Create a standardized framework for data integration

  • Structural Modeling:

    • Use homology modeling based on crystal structures of related proteins

    • Refine models using molecular dynamics simulations

    • Incorporate experimental constraints from cross-linking studies similar to those performed for PulG

  • Functional Mapping:

    • Overlay functional data onto structural models

    • Identify critical residues and regions for different functions

    • Create function-specific sub-models

  • Network Analysis:

    • Map the network of interactions between PulL and other T2SS components

    • Identify interaction hubs and critical nodes

    • Model the dynamics of network perturbation

  • Integrative Modeling Approaches:

    • Use hybrid methods that combine low-resolution structural data (e.g., SAXS, negative-stain EM) with high-resolution data (X-ray crystallography, NMR)

    • Implement computational approaches like Integrative Modeling Platform (IMP)

    • Develop mathematical models of T2SS assembly and function that incorporate both structural constraints and functional outcomes

  • Validation Strategies:

    • Design experiments to test predictions from integrated models

    • Use orthogonal techniques to confirm key findings

    • Implement iterative refinement based on new experimental data

What are promising new technologies for studying PulL dynamics within the assembled T2SS?

Several emerging technologies show promise for elucidating PulL dynamics:

  • Single-Molecule Techniques:

    • Single-molecule FRET to track conformational changes in PulL during T2SS assembly and function

    • Single-particle tracking to monitor PulL movement within bacterial membranes

    • Optical tweezers to measure forces involved in pseudopilus assembly

  • Advanced Imaging:

    • Super-resolution microscopy (STORM, PALM) to visualize T2SS assembly beyond the diffraction limit

    • Cryo-electron tomography of intact bacterial cells to capture the T2SS in its native environment

    • 4D imaging (3D + time) to track T2SS assembly dynamics

  • Protein Engineering Approaches:

    • Optogenetic tools to control PulL function with light

    • Incorporation of non-canonical amino acids for site-specific labeling

    • Split fluorescent proteins to visualize protein-protein interactions in real-time

  • In Silico Methods:

    • Machine learning approaches to predict PulL interactions and functional outcomes

    • Coarse-grained molecular dynamics to simulate large-scale conformational changes

    • Integrative modeling pipelines that combine multiple data types

  • Systems Biology Approaches:

    • Multi-omics integration to understand PulL in the context of global bacterial physiology

    • Network perturbation analysis to map functional relationships

    • Synthetic biology approaches to reconstitute minimal functional T2SS units

How might comparative genomics inform our understanding of PulL evolution and specialization across bacterial species?

Comparative genomics can provide valuable insights into PulL evolution and specialization:

  • Phylogenetic Analysis:

    • Construct comprehensive phylogenetic trees of PulL homologs across bacterial species

    • Identify patterns of co-evolution with other T2SS components

    • Map evolutionary rates to protein structure to identify conserved functional regions

  • Genomic Context Analysis:

    • Examine the organization of pulL and other T2SS genes across species

    • Identify synteny patterns and operon structures

    • Detect horizontal gene transfer events that may have shaped T2SS evolution

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Perform codon usage analysis to detect translation optimization

    • Identify signatures of host-pathogen co-evolution in pathogenic species

  • Functional Diversification:

    • Compare PulL sequences from bacteria with different ecological niches

    • Correlate sequence variations with known phenotypic differences

    • Identify species-specific adaptations in T2SS function

  • Structural Conservation:

    • Map sequence conservation onto structural models

    • Identify structurally constrained regions that maintain core functions

    • Detect flexible regions that may allow for functional specialization

What are the potential applications of T2SS and PulL research in biotechnology and medicine?

Research on T2SS and PulL has several potential applications:

  • Antimicrobial Development:

    • Design of inhibitors targeting PulL and other T2SS components as novel antibacterials

    • Development of antivirulence strategies that disrupt secretion without selecting for resistance

    • Creation of screening platforms to identify compounds that block T2SS assembly

  • Vaccine Development:

    • Use of T2SS-secreted proteins as vaccine antigens

    • Development of attenuated bacterial strains with modified T2SS for live vaccines

    • Design of adjuvants based on immunomodulatory T2SS substrates

  • Protein Engineering and Biotechnology:

    • Engineering of T2SS for secretion of heterologous proteins in bacterial expression systems

    • Development of cell surface display technologies based on T2SS components

    • Creation of bacterial biosensors using modified T2SS pathways

  • Diagnostic Applications:

    • Development of rapid diagnostic tests targeting T2SS-secreted proteins

    • Creation of biomarkers based on T2SS activity in clinical samples

    • Design of imaging probes for tracking bacterial infections in vivo

  • Environmental Applications:

    • Engineering of bacteria with modified T2SS for bioremediation

    • Development of biosensors for environmental monitoring

    • Creation of biocontrol agents targeting pathogenic bacteria through T2SS inhibition

Table 1: Comparison of Type II Secretion System Components Across Bacterial Species

SpeciesPulL HomologKey Interacting PartnersAssociated Secreted EnzymesTemperature RegulationRole in Virulence
Klebsiella oxytocaPulLPulF, PulM, PulGPullulanaseNot determinedNot determined
Legionella pneumophilaLspLLspM, other Lsp componentsProtease, RNase, lipase, phospholipases, acid phosphatasesIncreased expression at lower temperatures (17-30°C)Required for intracellular growth and lung infection
Pseudomonas aeruginosaXcpYXcpZ, XcpXElastase, exotoxin A, lipaseLinked to quorum sensing regulationContributes to virulence in multiple infection models

Table 2: Key Molecular Interactions in Type II Secretion System Assembly

InteractionFunctional SignificanceExperimental EvidenceReference
Pseudopilin (e.g., PulG) - PulL/F/M complexAssembly factor interaction necessary for pseudopilus biogenesisHydrophobic patches on protomers may be masked by assembly factors (PulF/L/M)
Intermolecular salt bridges between pseudopilin subunitsCritical for pseudopilus stability and functionDemonstrated using single and complementary charge inversions
Transmembrane segment interactionsEssential for pilus assembly and stabilizationPosition-specific cross-linking using double-cysteine substitutions
PilD-processed pseudopilinsRequired for incorporation into functional T2SST2SS-dependent secretion requires PilD processing

Table 3: Phenotypic Effects of Type II Secretion System Mutations

Mutation TypeGrowth at 37°CGrowth at Lower Temperatures (17-30°C)Secreted Enzyme ActivitiesIntracellular ReplicationIn Vivo Virulence
pilD deletionNormalSeverely reducedAbolishedDefectiveReduced
lspDE deletionNormalSeverely reducedAbolishedDefectiveReduced
lspF/G mutationNormalSeverely reducedAbolishedDefectiveReduced
Type IV pilus mutations (pilQ, pspA, pilE)NormalNormalNormalNormalNormal
dot/icm mutationsNormalNot determinedNormalDefectiveReduced

Data compiled from references and .

Research Findings: Temperature-Dependent Regulation of T2SS

Recent studies have revealed a novel role for the Type II secretion system in bacterial adaptation to lower temperatures. In Legionella pneumophila, transcription of pilD, which encodes the prepilin peptidase essential for both type IV pilus biogenesis and type II protein secretion, increases progressively as growth temperature decreases from 37°C to 30°C, 25°C, and 17°C .

Most significantly, L. pneumophila strains with mutations in the type II secretion system genes (including lspDE, lspF, and others) demonstrate a dramatically reduced ability to grow in broth and form colonies on agar at lower temperatures (17-30°C), while showing normal growth at 37°C . This temperature-dependent phenotype appears to be specifically linked to type II secretion rather than type IV piliation, as mutations that specifically disrupt type IV pili without affecting secretion do not impair low-temperature growth .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.