Recombinant Type IV secretion system protein ptlB homolog (ptlB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Pathogenesis

ptlB contributes to bacterial virulence through:

  • Toxin Secretion: In Bordetella, ptlB is essential for exporting pertussis toxin (PT), a key virulence factor causing whooping cough .

  • Immune Evasion: By facilitating PT release, ptlB indirectly suppresses host immune responses, including neutrophil extracellular trap (NET) formation .

  • Horizontal Gene Transfer: T4SSs like ptlB-associated systems enable DNA conjugation, promoting antibiotic resistance spread .

Recombinant Production Methods

Recombinant ptlB is produced using heterologous expression systems :

Host SystemAdvantagesChallenges
E. coliRapid growth, cost-effectiveLack of eukaryotic post-translational modifications
YeastProper protein folding, secretionNon-human glycosylation patterns
Mammalian CellsHuman-like PTMs (e.g., glycosylation)High cost, complex culture requirements

E. coli remains the primary host for ptlB production due to scalability, though mammalian systems are explored for vaccine applications requiring native-like modifications .

Applications in Vaccine Development

ptlB has garnered interest for:

  • Subunit Vaccines: Recombinant ptlB serves as an antigen to elicit immune responses against Bordetella infections .

  • Adjuvant Studies: Its role in toxin secretion makes it a target for blocking pathogenicity, potentially enhancing vaccine efficacy .

  • Diagnostic Tools: ptlB-specific antibodies are used in ELISA assays to detect Bordetella infections .

Research Findings and Current Studies

Recent studies highlight:

  • Phagocytosis Resistance: Bordetella strains lacking functional T4SS components like ptlB show increased uptake by polymorphonuclear leukocytes (PMNs), underscoring its role in immune evasion .

  • Transcriptional Regulation: ptlB expression correlates with virulence gene activation, including nucleases and proteases that degrade host defenses .

  • Structural Insights: Cryo-EM studies of related T4SSs (e.g., Legionella pneumophila Dot/Icm) suggest ptlB forms part of a dynamic channel-pilus complex .

Challenges and Future Directions

  • Structural Resolution: High-resolution structures of ptlB are needed to elucidate its interactions within the T4SS .

  • Host Adaptation: Engineering yeast or mammalian systems to produce ptlB with human-compatible post-translational modifications remains a priority .

  • Therapeutic Targeting: Small-molecule inhibitors disrupting ptlB function could neutralize Bordetella virulence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that specific tag.
Synonyms
ptlB; BPP4310; Type IV secretion system protein PtlB homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Target Names
ptlB
Target Protein Sequence
MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRRRLRKP
Uniprot No.

Target Background

Database Links

KEGG: bpa:BPP4310

Protein Families
VirB3 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Type IV Secretion System and what role does PtlB play in it?

    Type IV secretion systems (T4SSs) are versatile bacterial transport mechanisms found in both Gram-negative and Gram-positive bacteria. These complex systems secrete diverse substrates ranging from single proteins to protein-protein and protein-DNA complexes. T4SSs typically consist of 12 core components (VirB1-VirB11 and VirD4) organized into ATP-powered, double-membrane-spanning complexes .

    PtlB is a homolog of the VirB4 component and functions as one of the three crucial ATPases that power substrate secretion in the Ptl system. It works in conjunction with other components to facilitate the assembly and function of the secretion system, providing energy for the translocation of toxin subunits across the bacterial membranes .

  • How does the Ptl system differ from other Type IV secretion systems?

    While most T4SSs are involved in conjugative DNA transfer or effector protein translocation directly into host cells, the Ptl system has evolved specifically for the secretion of the multisubunit Pertussis toxin (PT) into the extracellular environment rather than into target cells.

    The Ptl system demonstrates a distinctive feature in that it requires holotoxin assembly for efficient secretion, whereas other T4SSs often transport unfolded or partially folded substrates. Research has shown that individual PT subunits (S1 or B oligomer) cannot be efficiently secreted by the Ptl system in isolation; only the assembled holotoxin form is properly exported .

  • What are the structural characteristics of PtlB protein?

    PtlB, as a VirB4 homolog, is likely a large protein with multiple domains including nucleotide-binding regions that enable its ATPase activity. Structural studies of T4SS components suggest that PtlB assembles into hexameric complexes at the cytoplasmic face of the inner membrane.

    The protein contains conserved Walker A and Walker B motifs typical of ATPases, which are essential for nucleotide binding and hydrolysis, respectively. These motifs provide the energy required for substrate translocation through the secretion system .

  • What methods are recommended for expressing recombinant PtlB protein?

    Recombinant expression of PtlB typically involves:

    • Codon optimization: Adjusting the coding sequence to match the codon usage bias of the expression host

    • Vector selection: Using expression vectors with inducible promoters (such as T7) to control expression levels

    • Host selection: E. coli BL21(DE3) or derivatives are commonly used for initial expression trials

    • Expression conditions optimization: Testing various induction temperatures (16-30°C), inducer concentrations, and duration of expression

    • Solubility enhancement: Using fusion tags (His, MBP, GST) or co-expression with chaperones to improve solubility

    For membrane-associated proteins like PtlB, specialized expression systems that facilitate proper membrane insertion may be necessary, such as cell-free systems or membrane-mimetic environments .

  • How can I verify the functionality of recombinant PtlB?

    Functional verification of recombinant PtlB should include:

    • ATPase activity assay: Measuring ATP hydrolysis rates using colorimetric phosphate detection methods

    • Oligomerization analysis: Using size exclusion chromatography or native PAGE to confirm proper complex formation

    • Interaction studies: Employing pull-down assays or co-immunoprecipitation to verify interactions with other Ptl system components

    • Complementation assays: Testing whether the recombinant protein can restore function in PtlB-deficient bacterial strains

    These analyses should be conducted under conditions that mimic the native environment of PtlB, including appropriate buffer conditions and the presence of essential cofactors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.