Recombinant Type IV secretion system protein ptlD homolog (ptlD)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

PtlD is a 463-amino-acid (aa) protein encoded by the ptlD gene in B. pertussis. It belongs to the Ptl transporter, a nine-protein complex (PtlA–PtlI) homologous to the VirB system in Agrobacterium tumefaciens. The Ptl transporter facilitates the translocation of PT, a key virulence factor, across bacterial membranes. PtlD is part of the transporter’s “core” segment, bridging the inner membrane (engine) and outer membrane (pilus-like structure) components .

Domain Organization

Domain Region (aa)FunctionKey Findings
C-terminal 72 aa (392–463)Stabilizes PtlE, PtlF, and PtlHDeletion of this region reduces PtlE, PtlF, and PtlH levels by >50% .
C-terminal 10 aa (425–434)Contributes to transporter stabilityPartial deletion of this stretch minimally affects stability, suggesting compensatory mechanisms .
Full-length (25–463 aa)Essential for PT secretionRequired for toxin translocation; C-terminal stabilization alone is insufficient for secretion .

PtlD shares homology with VirB6 from the VirB system, though it is larger (463 aa vs. 295 aa in VirB6) . The C-terminal domain interacts with PtlE, PtlF, and PtlH to maintain transporter integrity, while the N-terminal region likely participates in secretion machinery assembly .

Role in Transporter Stability

  • PtlD Deletion: In B. pertussis ΔptlD mutants, PtlE, PtlF, and PtlH levels drop significantly, confirming PtlD’s role in stabilizing these proteins .

  • Complementation: Expressing full-length PtlD restores PtlE, PtlF, and PtlH levels, but secretion remains impaired. The C-terminal 72 aa alone partially stabilizes these proteins but does not rescue secretion .

  • C-Terminal Subregions: A 10-aa stretch (425–434) contributes to stability but is not indispensable, as other regions compensate .

Homology to VirB6

PtlD’s C-terminal region aligns with VirB6, which stabilizes VirB8, VirB9, and VirB11 in the VirB system. This suggests conserved mechanisms across T4SSs for maintaining transporter stability .

Applications in Research

  1. T4SS Assembly Studies: PtlD’s role in stabilizing PtlE, PtlF, and PtlH makes it a model for investigating T4SS core–engine interactions .

  2. PT Secretion Mechanisms: Full-length PtlD is essential for PT translocation, highlighting its potential as a target for disrupting B. pertussis pathogenicity .

  3. Vaccine Development: Understanding PtlD’s function could inform strategies to block PT secretion, reducing bacterial virulence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ptlD; BPP4312; Type IV secretion system protein PtlD homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-463
Protein Length
Full Length of Mature Protein
Species
Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Target Names
ptlD
Target Protein Sequence
SVDDPTRAGGDNRVRALRADQARRDVLLTACRDDPGHRRGEPDCVNAERAQALQQWQAAA MTSVDAAFSDLAGALRNAAPRRMEAAIVRLTRQLQPLVYSMMTLLVLLTGYALLARRDRP FEWHIRHALLVAVVTSLALSPDHYLSTVVAGVQDVAGWLSGPWTAPDGAAGRGGLAQLDQ FAAQAQAWVAQLAGQAANDANPGSAVNWLLCAMIVATSAGGWLCLAASLLIVPGLIVTLL LSLGPLFLVLLLFPALQRWTNAWLGALVRALVFMALGTPAVGLLSDVLAGALPAGLPQRF ATDPLRSTMLAATLCATATLMLLTLVPLASSVNAGLRRRLWPNAAHPGLAQAHRQAAARQ YAPRPAAAAAAAGPHQAGTYAASATPAPAPARPAPSFPAHAYRQYALGGARRPPPRVRRD DRPAPAPDRRVLPRKPNLP
Uniprot No.

Target Background

Database Links

KEGG: bpa:BPP4312

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Type IV secretion system protein PtlD homolog and what is its biological significance?

The Type IV secretion system protein PtlD homolog is a critical component of bacterial type IV secretion systems (T4SS). In Bordetella parapertussis, PtlD (UniProt accession: Q7W2U2) functions as part of the Ptl transporter system responsible for secreting pertussis toxin . PtlD plays a crucial structural role in the secretion apparatus, contributing to the stability of other protein components within the T4SS complex. Research has demonstrated that PtlD is specifically required for maintaining the stability of several other Ptl proteins, including PtlE, PtlF, and PtlH, which are essential for proper toxin secretion .

The biological significance of PtlD extends to bacterial pathogenesis, as the proper functioning of T4SS is necessary for the delivery of virulence factors that contribute to bacterial colonization and disease progression. The structural integrity of the secretion system, maintained in part by PtlD, is therefore directly relevant to bacterial virulence mechanisms.

How does PtlD relate to other type IV secretion system components?

PtlD is homologous to VirB6, a component found in other bacterial T4SS . Within the Ptl transporter system of Bordetella species, PtlD functions as part of a nine-protein complex (PtlA through PtlI) that collectively forms the secretion apparatus . The relationship between PtlD and other system components appears to be both structural and functional.

Studies have shown that deletion of ptlD results in significant decreases in the amounts of PtlE, PtlF, and PtlH detected in bacterial cells, indicating that PtlD plays a stabilizing role for these proteins . Similarly, in other T4SS systems, deletion of virB6 (the ptlD homologue) correlates with reductions in several VirB transporter proteins, including VirB8 (PtlE homologue), VirB9 (PtlF homologue), and VirB11 (PtlH homologue) . This suggests a conserved stabilizing function across different bacterial secretion systems.

What are the key structural domains of PtlD and their functions?

The PtlD protein contains several important structural domains that contribute to its function in the type IV secretion system. Based on available data, the C-terminal region of PtlD is particularly significant for its stabilizing function. Research has demonstrated that a region limited to the C-terminal 72 amino acids of PtlD (amino acids 392 to 463) is sufficient for maintaining the stability of other Ptl proteins .

The complete amino acid sequence of PtlD includes multiple hydrophobic regions that likely facilitate membrane insertion and protein-protein interactions within the secretion apparatus . The protein's full amino acid sequence (provided by commercial suppliers) reveals potential transmembrane domains and interaction interfaces that may be critical for its function in the secretion system assembly .

How does the C-terminal domain of PtlD contribute to protein stability?

The C-terminal domain of PtlD (amino acids 392-463) plays a crucial role in stabilizing other components of the Ptl transporter. Experimental evidence has shown that this region alone is sufficient to maintain the stability of PtlE, PtlF, and PtlH proteins . The mechanism by which the C-terminus achieves this stabilization likely involves specific protein-protein interactions that prevent degradation of these components.

Research suggests that the C-terminal domain may serve as a structural scaffold that facilitates proper assembly of the secretion apparatus. Without this stabilizing influence, key components of the secretion system become susceptible to degradation, compromising the integrity of the entire complex . The specific molecular interactions that mediate this stabilization represent an important area for further research.

What are the optimal conditions for handling recombinant PtlD protein?

Based on commercial protocols for recombinant PtlD, the protein should be stored in a Tris-based buffer with 50% glycerol optimized for protein stability . For long-term storage, maintaining the protein at -20°C or -80°C is recommended, with the caveat that repeated freezing and thawing cycles should be avoided as they can compromise protein integrity .

For working with PtlD in laboratory settings, researchers should prepare aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles . When designing experiments, it's important to consider that the recombinant protein may contain various tags depending on the production process, which should be accounted for in experimental design and data interpretation.

What methods are most effective for studying PtlD interactions with other secretion system components?

Several methodological approaches can be employed to study PtlD interactions with other components of the type IV secretion system:

MethodApplicationAdvantagesLimitations
Co-immunoprecipitationIdentify direct protein-protein interactionsDetects native interactionsMay miss transient interactions
Bacterial two-hybrid assaysScreen for potential interaction partnersHigh-throughput capabilityPotential for false positives
Complementation studiesVerify functional interactions in vivoPhysiologically relevantComplex to interpret
Cross-linking coupled with mass spectrometryMap interaction interfacesProvides structural informationTechnical complexity

Complementation studies have proven particularly valuable, as demonstrated in research where a plasmid expressing the full-length ptlD gene was able to restore the stability of PtlE, PtlF, and PtlH in a ptlD deletion strain . Such approaches provide functional evidence of protein interactions in their native environment.

How do mutations in different domains of PtlD affect secretion system assembly and function?

Mutations in PtlD can have profound effects on secretion system assembly and function, particularly through destabilization of other components. Research has shown that complete deletion of ptlD results in significant reduction in the levels of PtlE, PtlF, and PtlH proteins . This suggests that mutations that compromise PtlD's structure or interaction capabilities would similarly impact secretion system integrity.

The C-terminal domain (amino acids 392-463) appears particularly crucial, as this region alone can maintain the stability of other Ptl components . Mutations in this domain would likely have the most dramatic effects on secretion system assembly. A systematic mutational analysis approach could help identify specific residues critical for the stabilizing function of PtlD and map interaction interfaces with other secretion system components.

What are the molecular mechanisms by which PtlD stabilizes other Ptl proteins?

The exact molecular mechanisms by which PtlD stabilizes PtlE, PtlF, and PtlH remain to be fully elucidated, but several hypotheses can be proposed based on available data:

  • Direct protection from proteolysis through physical interaction

  • Facilitation of proper folding or assembly into the secretion complex

  • Creation of a microenvironment that prevents exposure to degradative enzymes

  • Modulation of protein conformation to mask degradation signals

Experimental evidence has demonstrated that complementation with a plasmid expressing full-length PtlD can restore the stability of these proteins in a ptlD deletion strain . This confirms the causal relationship between PtlD expression and Ptl protein stability but does not fully resolve the molecular mechanism. Advanced structural studies, including cryo-electron microscopy of the assembled complex, could provide further insights into these stabilization mechanisms.

How does PtlD compare to its homologues in other bacterial species?

PtlD shares homology with VirB6, a component of type IV secretion systems in other bacterial species . Comparative studies between PtlD and its homologues reveal both conserved and divergent features that reflect the adaptation of secretion systems to different bacterial lifestyles and substrates.

In functional terms, both PtlD and VirB6 appear to play stabilizing roles for other components of their respective secretion systems. Deletion of virB6 results in reductions of VirB8, VirB9, and VirB11 proteins under conditions favoring protein turnover, mirroring the effects of ptlD deletion on their Ptl homologues . This functional conservation suggests that the stabilizing role represents a fundamental aspect of type IV secretion system assembly.

What evolutionary insights can be gained from studying PtlD across different bacterial species?

Evolutionary analysis of PtlD and its homologues across bacterial species can provide valuable insights into the adaptation and specialization of type IV secretion systems. The conservation of certain domains, particularly the C-terminal region important for protein stabilization, would indicate fundamental structural requirements for secretion system function.

Comparative genomic approaches could reveal how variations in PtlD structure correlate with differences in secretion system substrates or host ranges among different bacterial pathogens. Such evolutionary perspectives not only enhance our understanding of bacterial pathogenesis but may also inform the development of novel antimicrobial strategies targeting conserved features of these essential virulence mechanisms.

What are the best approaches for expressing and purifying PtlD for functional studies?

Recombinant PtlD expression requires careful consideration of several factors to obtain functional protein for research purposes. Commercial sources typically provide the protein expressed with tags that aid in purification, with the tag type determined during the production process to optimize for stability and function .

For researchers expressing PtlD in their own laboratories, considerations should include:

  • Expression system selection: E. coli systems are commonly used, but expression in the native Bordetella species may better preserve functional characteristics

  • Codon optimization: Adapting the coding sequence to the expression host's codon usage patterns

  • Solubility enhancement: Including fusion partners or solubility tags to improve protein solubility

  • Purification strategy: Designing a purification scheme that maintains protein stability and function

The expression region from amino acids 25-463 appears to be significant based on commercial recombinant protein information . Including this full region while avoiding the signal peptide would likely yield the most functionally relevant protein for experimental studies.

How can researchers design complementation studies to investigate PtlD function?

Complementation studies represent a powerful approach for investigating PtlD function in its native context. Based on successful complementation experiments documented in the literature, researchers should consider the following design elements:

  • Construction of a ptlD deletion strain using precise genetic techniques to avoid polar effects on adjacent genes

  • Development of a complementation plasmid containing the full-length ptlD gene under the control of an appropriate promoter (such as the lac promoter used in previous studies)

  • Verification of PtlD expression using immunoblotting or other protein detection methods

  • Assessment of the stability of PtlE, PtlF, and PtlH proteins in both the deletion strain and the complemented strain

  • Functional assays to evaluate secretion system activity, such as pertussis toxin secretion measurements

Such complementation approaches allow researchers to establish causal relationships between PtlD expression and specific phenotypes, as well as to investigate the functional significance of specific domains through the use of truncated or mutated versions of the protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.