Recombinant Type IV secretion system protein ptlE homolog (ptlE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can serve as a guideline for your process.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ptlE; BPP4313; Type IV secretion system protein PtlE homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Target Names
ptlE
Target Protein Sequence
MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATM LPLKTTIPYLIEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHD YDYVRLLSAPAVRHDYETSYEAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRR DADGQGAAESSIWVATVAFAYDQPRALTQAQRWLNPLGFAVTSYRVDAEAGQP
Uniprot No.

Target Background

Database Links

KEGG: bpa:BPP4313

Protein Families
VirB8 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Type IV secretion system and what role does PtlE play in its function?

The Type IV secretion system (T4SS) is a specialized nanomachine assembled on the bacterial cell surface that is evolutionarily related to bacterial conjugation systems. These systems play a pivotal role in infection by delivering numerous virulence factors, called effectors, into host cells. These effector proteins manipulate host cellular processes to benefit the bacterial pathogen .

PtlE is a component of the Type IV secretion system that contributes to the formation of the core complex. Similar to other components like DotC, DotD, DotF, DotG, and DotH in the Dot/Icm T4SS of Legionella pneumophila, PtlE likely participates in forming the ring-shaped structure that spans the bacterial cell envelope, creating a channel through which effector proteins are translocated . PtlE homologs are believed to be involved in maintaining the structural integrity of the complex and facilitating proper assembly of the secretion apparatus.

How does the structure of Type IV secretion system core complexes relate to function?

The T4SS core complex exhibits a ring-shaped structure as revealed by transmission electron microscopy studies. This architecture is critical for its function as a protein transport channel. In Legionella pneumophila, the core complex of the Dot/Icm T4SS is composed of at least five proteins: DotC, DotD, DotF, DotG, and DotH .

The structural organization follows a specific pattern where some components form an outer membrane subcomplex, while others like DotG form a central channel spanning both inner and outer membranes. This arrangement creates a continuous conduit through which effector proteins can be transported from the bacterial cytoplasm directly into host cells . The intricate assembly of these components ensures efficient protein translocation while maintaining membrane integrity. Understanding the structure-function relationship of PtlE homologs within this complex is essential for comprehending the mechanism of effector translocation.

What are the evolutionary relationships between different Type IV secretion system components across bacterial species?

Type IV secretion systems are evolutionarily related to bacterial conjugation systems and are found across diverse bacterial species . Comparative genomic analyses reveal that the core components of T4SS are conserved, though variations exist in the accessory proteins that may confer species-specific functions.

The evolutionary conservation of proteins like PtlE homologs suggests their essential role in the fundamental mechanism of protein secretion. Phylogenetic studies indicate that T4SS components have co-evolved to maintain functional interactions while adapting to different bacterial lifestyles and host environments. Homology-based approaches can be valuable for identifying and characterizing T4SS components in newly sequenced bacterial genomes, similar to how homology-based pipelines have been developed for post-translational modification predictions .

What expression systems are most effective for producing recombinant PtlE protein?

For recombinant expression of Type IV secretion system proteins like PtlE, several expression systems can be employed depending on the research objectives:

When designing expression constructs, researchers should consider adding affinity tags (His6, GST, MBP) to facilitate purification while ensuring these additions don't interfere with protein function. Codon optimization for the expression host and temperature optimization during induction phases can significantly improve yield and solubility of the recombinant PtlE protein.

How can homology modeling approaches be used to predict PtlE structure?

Homology modeling represents a valuable approach for predicting the structure of PtlE when experimental structures are unavailable. The process involves:

  • Template identification: Identifying structurally characterized homologs of PtlE from other T4SS components. The DotG, DotF, and DotH proteins from Legionella pneumophila T4SS can serve as potential templates if they share sequence similarity with PtlE .

  • Sequence alignment: Creating accurate sequence alignments between PtlE and the template structures, focusing on conserved domains and motifs.

  • Model building: Generating three-dimensional models based on the alignment and template structures using software like MODELLER, SWISS-MODEL, or Rosetta.

  • Model validation: Assessing the quality of the model through metrics like RMSD, Ramachandran plots, and QMEAN scores.

This approach can be enhanced by incorporating cross-promotion E-value (CPE) benchmarks, similar to those used in PTMProber for post-translational modification prediction . When sequence identity with known structures is low, integrating multiple templates and employing ab initio modeling for divergent regions can improve model accuracy. The resulting structural predictions can guide hypothesis generation about PtlE function and interactions within the T4SS complex.

What purification strategies yield the highest purity and activity for recombinant PtlE?

Purifying recombinant PtlE requires specialized approaches due to its likely membrane association. Effective strategies include:

  • Detergent screening: Systematic testing of detergents (DDM, LDAO, Triton X-100) to identify optimal conditions for extracting PtlE from membranes while maintaining its native conformation.

  • Two-step affinity chromatography: Using tandem purification steps (e.g., Ni-NTA followed by size exclusion chromatography) to achieve high purity.

  • On-column refolding: For proteins expressed as inclusion bodies, gradual removal of denaturants while bound to affinity resin can improve recovery of properly folded protein.

  • Stability optimization: Addition of glycerol (5-10%) and reducing agents to purification buffers can enhance protein stability.

The purity of the final preparation should be assessed using SDS-PAGE, with protein identity confirmed via Western blotting or mass spectrometry. Activity assessments would depend on the specific function attributed to PtlE, potentially including oligomerization assays, lipid binding assays, or interaction studies with other T4SS components.

How can CRISPR-Cas9 be used to study PtlE function in pathogenic bacteria?

CRISPR-Cas9 genome editing provides powerful approaches for investigating PtlE function in native bacterial contexts:

  • Gene knockout studies: Complete deletion of the ptlE gene can reveal its essentiality and the consequences of its absence on T4SS assembly and function.

  • Precise point mutations: Homology-directed repair (HDR) can be used to introduce specific mutations in the ptlE gene to study structure-function relationships . This approach requires:

    • Design of guide RNAs targeting the ptlE locus

    • Creation of donor DNA templates containing the desired mutations flanked by homology arms

    • Optimization of HDR conditions to improve editing efficiency

  • Domain swapping: Replacing domains of PtlE with corresponding regions from homologs in other bacterial species can identify species-specific functions.

  • Tagged variants: Introducing epitope tags or fluorescent protein fusions at the genomic locus can facilitate visualization and purification of native PtlE.

When designing HDR templates for precise modifications, silent mutations should be incorporated to prevent re-cutting by Cas9 after successful editing . The efficiency of HDR can be improved by synchronizing cells or modulating cell cycle progression, as HDR primarily occurs during S and G2 phases .

What experimental approaches can resolve protein-protein interactions between PtlE and other T4SS components?

Understanding the interaction network of PtlE within the T4SS complex requires complementary approaches:

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can identify direct binary interactions between PtlE and other T4SS components.

  • Co-immunoprecipitation: Using antibodies against native PtlE or epitope-tagged versions to pull down interacting partners, followed by mass spectrometry identification.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry analysis can map interaction interfaces at amino acid resolution.

  • Surface plasmon resonance (SPR): Quantitative measurements of binding affinities between purified PtlE and partner proteins.

  • Cryo-electron microscopy: Structural determination of the entire T4SS complex or subcomplexes containing PtlE can reveal the spatial arrangement and interfaces between components, similar to the structural studies performed on the Legionella pneumophila Dot/Icm T4SS .

Integration of interaction data with structural information can generate comprehensive models of how PtlE contributes to T4SS assembly and function. These models can then guide targeted mutational studies to validate specific interaction interfaces.

How do post-translational modifications affect PtlE function and T4SS assembly?

Post-translational modifications (PTMs) can significantly influence protein function, and may be important regulators of PtlE activity and T4SS assembly:

  • Identification of PTMs: Mass spectrometry-based proteomics approaches can identify PTMs on native or recombinant PtlE. Additionally, computational prediction tools like PTMProber can be employed to predict potential modification sites based on homology to known modified sites in other proteins .

  • Functional significance: Site-directed mutagenesis of modified residues (replacing them with non-modifiable amino acids) can reveal the importance of specific PTMs for PtlE function.

  • Regulation of modifications: Identifying the enzymes responsible for adding or removing PTMs on PtlE can provide insights into how T4SS activity is regulated in response to environmental cues.

The PTMProber pipeline could be particularly valuable for predicting PTMs on PtlE in organisms lacking experimental PTM data, as it achieves over 58.8% recall with high precision using cross-promotion E-value benchmarks . Understanding the PTM landscape of PtlE could reveal regulatory mechanisms controlling T4SS assembly and activity during different stages of bacterial infection.

What biophysical techniques are most informative for characterizing PtlE structure?

Multiple complementary biophysical approaches can provide insights into PtlE structure:

Integration of data from multiple techniques can overcome the limitations of individual methods. For instance, combining low-resolution electron microscopy data with high-resolution structures of individual domains determined by NMR or X-ray crystallography can generate comprehensive structural models.

How can experimental designs based on Plackett-Burman methods optimize PtlE expression and purification?

The Plackett-Burman design provides an efficient approach for optimizing multiple parameters simultaneously with a minimal number of experiments . For PtlE expression and purification, this approach can be implemented as follows:

  • Parameter selection: Identify key variables affecting PtlE expression and purification, such as:

    • Induction temperature

    • Inducer concentration

    • Expression duration

    • Cell density at induction

    • Buffer pH

    • Salt concentration

    • Detergent type and concentration

  • Experimental design: Create a Plackett-Burman matrix where each combination of parameter levels appears the same number of times throughout all experimental runs . For example, a 12-run design could evaluate 11 different parameters at high (+) or low (-) levels, as shown in the table below:

RunTempIPTGTimeODpHNaClDet1Det2GlycRedStab
1+++++++++++
2-+-+++---+-
3--+-+++---+
....................................
12+-+++---+--
  • Analysis: Statistical evaluation of results to identify the most significant parameters affecting PtlE yield and purity.

  • Optimization: Further refinement of significant parameters through response surface methodology or central composite design.

This systematic approach can significantly reduce the time and resources required to optimize conditions for PtlE production, potentially improving yield and quality for subsequent structural and functional studies .

What functional assays can effectively measure PtlE activity in vitro and in vivo?

Assessing PtlE function requires assays that capture its role in T4SS assembly and effector translocation:

In vitro assays:

  • Oligomerization assays: Size exclusion chromatography, analytical ultracentrifugation, or native PAGE to assess the ability of PtlE to form higher-order structures.

  • Membrane binding assays: Liposome flotation assays or surface plasmon resonance with lipid bilayers to quantify membrane interaction.

  • Protein-protein interaction assays: ELISA, SPR, or isothermal titration calorimetry to measure binding to other T4SS components.

In vivo assays:

  • Effector translocation assays: Measuring the delivery of known T4SS effectors into host cells using reporter fusions or immunoblotting of fractionated host cells.

  • Complementation studies: Testing whether wild-type or mutant versions of PtlE can restore T4SS function in ptlE deletion strains.

  • Subcellular localization: Immunofluorescence microscopy or fractionation studies to determine proper localization of PtlE and other T4SS components.

  • Host cell phenotypes: Assessing pathogen-specific phenotypes that depend on functional T4SS, such as intracellular replication for Legionella pneumophila or cAMP production for Bordetella pertussis.

Correlation between results from these complementary assays can provide a comprehensive understanding of PtlE function in the context of T4SS assembly and activity.

How can structural information about PtlE contribute to the development of novel antimicrobial strategies?

Detailed structural information about PtlE and its interactions within the T4SS complex can inform antimicrobial development in several ways:

  • Structure-based inhibitor design: High-resolution structures can guide the design of small molecules that specifically bind to PtlE and disrupt its function or interactions.

  • Peptide inhibitors: Identification of interaction interfaces between PtlE and other T4SS components can lead to the development of peptide inhibitors that compete for binding.

  • Allosteric modulators: Understanding the conformational dynamics of PtlE may reveal allosteric sites that could be targeted to lock the protein in inactive conformations.

As described for the Legionella pneumophila T4SS, detailed structural data about nanomachine assembly can aid in the development of drug therapies targeting bacterial pathogens . Since T4SS is essential for virulence in many pathogens but not generally required for bacterial survival in vitro, targeting this system could potentially reduce the selection pressure for resistance compared to conventional antibiotics.

What are the current technical limitations in studying PtlE and how might they be overcome?

Several technical challenges complicate PtlE research:

  • Membrane protein expression: Like many T4SS components, PtlE likely associates with membranes, making high-yield expression and purification difficult. Alternative expression systems like cell-free systems with lipid nanodiscs might improve yield and native folding.

  • Structural determination: The size and complexity of T4SS components make high-resolution structural studies challenging. Hybrid approaches combining cryo-EM of the full complex with high-resolution structures of domains may be more feasible.

  • Functional redundancy: Potential overlapping functions with other T4SS components may mask phenotypes in single-gene deletion studies. CRISPR-based approaches for generating conditional or combinatorial mutants could address this issue.

  • Host-pathogen context: In vitro studies may not fully recapitulate the dynamic nature of T4SS assembly and function during infection. Development of infection models that allow real-time monitoring of T4SS activity could provide more physiologically relevant insights.

Emerging technologies like cryo-electron tomography of bacterial cells in contact with host membranes could provide unprecedented views of T4SS assembly and function in a near-native context.

How does PtlE contribute to species-specific variations in T4SS function and host range?

The role of PtlE in determining T4SS specificity and host range remains an important research question:

  • Comparative genomics: Analysis of PtlE sequence variation across bacterial species could identify regions under positive selection that might contribute to host adaptation.

  • Domain swapping experiments: Creating chimeric proteins with domains from PtlE homologs of different species could identify regions responsible for species-specific functions.

  • Effector recognition: Investigation of whether PtlE directly interacts with effector proteins and contributes to substrate selection.

  • Host factor interactions: Identification of potential interactions between PtlE and host cell factors that might influence host tropism.

Understanding how variations in PtlE contribute to T4SS functional diversity could provide insights into bacterial adaptation strategies and host-pathogen co-evolution. This knowledge could inform predictions about emerging pathogens and guide the development of targeted intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.