Recombinant Type IV secretion system protein ptlG homolog (ptlG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ptlG; BPP4315; Type IV secretion system protein PtlG homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Target Names
ptlG
Target Protein Sequence
MLNRPSSPDGGEAHAWPPDPEIPVFANAEHAHRRPLRWMFALVAVALSCLLATGIWRSRA APPHAATQTVAPAGQALPPGRMFTVHPREPEPAPLPDMPAAPNPILPQPRPAPPVPPPPI RAPYDYDEPAPRRDSAALKSGPAMMVATAARLGQTERAGMAEDGVSADAATLIGRSVSRA TRSGGRDYRLLPGTFIDCILQTRIVTNVPGLTTCIVSRDVYSASGKRVLVPRGTTVVGEY RADLAQGSQRIYVAWSRLFMPSGLTIELASPAVDGTGAAGLPGVVDDKFAQRFGGALLLS VLGDATSYMLARATDARHGVNVNLTAAGTMNSLAASALNNTINIPPTLYKNHGDQIGILV ARPLDFSILRGTNE
Uniprot No.

Target Background

Database Links

KEGG: bpa:BPP4315

Protein Families
TrbI/VirB10 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of PtlG in Type IV Secretion Systems?

PtlG serves as a critical structural component in T4SS complexes, particularly in specialized systems like the pertussis toxin liberation (Ptl) system. Functionally, it contributes to the assembly and stabilization of the secretion machinery. Recent studies on T4SS-dependent bacterial antagonism suggest that structural proteins like PtlG may play essential roles beyond simply facilitating effector transport . To investigate PtlG function, researchers typically employ gene deletion studies followed by complementation with recombinant variants, coupled with protein-protein interaction analyses to map its position within the T4SS complex.

What experimental approaches are most effective for expressing and purifying recombinant PtlG?

The optimal methodological approach includes:

  • Vector Selection and Optimization: Clone the ptlG gene into expression vectors containing affinity tags (His6, GST, or MBP) with codon optimization for the host system.

  • Expression Conditions:

    • Test multiple E. coli strains (BL21(DE3), Arctic Express, Rosetta)

    • Optimize induction parameters (temperature: 16-30°C, IPTG: 0.1-1.0 mM)

    • Consider autoinduction media for membrane-associated proteins

  • Purification Strategy:

    StepMethodPurpose
    Cell lysisSonication/French press with detergentExtract membrane-associated proteins
    Primary captureIMAC or affinity chromatographyInitial purification
    Secondary purificationIon exchange chromatographyRemove contaminants
    Final polishingSize exclusion chromatographyEnsure homogeneity

Detergent screening is critical for maintaining protein stability and native conformation throughout the purification process.

How can researchers verify the structural integrity of purified recombinant PtlG?

Multiple complementary approaches should be employed:

  • Biophysical Characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Differential scanning fluorimetry to determine thermal stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm oligomeric state

  • Functional Validation:

    • In vitro reconstitution assays with other T4SS components

    • Protein-protein interaction studies with known binding partners

    • Liposome binding assays if membrane association is expected

The purified protein should demonstrate the expected molecular weight, secondary structure profile, and binding affinities to be considered structurally intact.

What model systems are appropriate for studying PtlG function in the context of T4SS?

Based on current research methodologies:

  • Bacterial Expression Systems:

    • Heterologous expression in laboratory strains (E. coli, B. subtilis)

    • Native expression in Bordetella or related species

    • Reconstituted systems with defined T4SS components

  • Interaction Models:

    Model SystemApplicationsLimitations
    Bacterial co-cultureStudies of T4SS-mediated antagonismComplex interactions
    Cell-free reconstitutionBiochemical mechanism studiesLacks cellular context
    Bacterial-mammalian co-cultureHost interaction studiesHost response variability

Recent studies on T4SS-dependent bacterial antagonism have successfully utilized co-culture systems to demonstrate the elimination of Gram-negative bacteria through T4SS activity .

How do mutations in conserved domains of PtlG affect T4SS assembly and function?

Systematic mutational analysis reveals domain-specific effects:

  • N-terminal Domain: Mutations typically disrupt protein-protein interactions, preventing incorporation into the T4SS complex.

  • Central Domain: Highly conserved residues are essential for structural integrity; mutations often result in complete loss of function.

  • C-terminal Domain: More tolerant to mutations, but specific residues are critical for substrate specificity or membrane interactions.

The methodological approach should include:

  • Alanine scanning mutagenesis of conserved residues

  • Expression level verification by western blotting

  • Bacterial two-hybrid or co-immunoprecipitation to assess protein interactions

  • Functional assays to measure T4SS activity (e.g., conjugation efficiency, bacterial antagonism)

What is the molecular mechanism of T4SS-dependent bacterial antagonism, and how might PtlG contribute?

Recent research has revealed that conjugative T4SS can mediate bacterial antagonism independently of effector proteins . The mechanistic details involve:

  • Contact-Dependent Process: The antagonistic activity requires direct contact between the T4SS-expressing cell and the target bacterium.

  • Membrane Perturbation Hypothesis: T4SS components, potentially including PtlG homologs, may form structures that disrupt membrane integrity of target cells.

  • Energy Depletion Model: The interaction may trigger energy-consuming stress responses in target cells, leading to metabolic collapse.

Methodologically, researchers can investigate this phenomenon using:

  • Time-lapse microscopy with fluorescently labeled bacteria

  • Membrane potential assays with voltage-sensitive dyes

  • ATP depletion measurements in target cells

  • Electron microscopy to visualize membrane perturbations

Studies have shown that a range of Gram-negative bacteria can be eliminated by this T4SS-dependent antagonism, with implications for bacterial community dynamics .

How does T4SS-mediated bacterial antagonism influence microbial community structure?

T4SS-dependent antagonism represents a previously underappreciated mechanism of bacterial competition with ecological significance:

  • Population Control: Bacteria expressing antagonistic T4SS can selectively eliminate susceptible competitors, creating population bottlenecks.

  • Spatial Organization: The contact-dependent nature of the antagonism creates structured communities with distinct spatial patterns.

  • Resistance Development: Selective pressure drives the evolution of resistance mechanisms in target populations.

Experimental ApproachKey MeasurementsResearch Applications
Mixed culture competitionPopulation dynamics, species ratiosCommunity ecology studies
Microfluidic devicesSingle-cell interactions, spatial patternsMechanistic investigations
Soil/water microcosmsCommunity shifts in complex environmentsEnvironmental microbiology

Research has demonstrated that conjugative T4SS from both RP4 and R388 plasmids can exhibit this antagonistic property, suggesting it may be widespread among T4SS-containing bacteria .

What techniques are most effective for studying protein-protein interactions involving PtlG within the T4SS complex?

Advanced methodological approaches include:

  • In Vivo Approaches:

    • Bacterial two-hybrid screening to identify interaction partners

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

    • FRET/FLIM analysis for quantifying interaction dynamics and affinities

  • In Vitro Approaches:

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping interaction interfaces

  • Structural Approaches:

    • Cryo-electron microscopy of the assembled T4SS complex

    • X-ray crystallography of PtlG in complex with binding partners

    • Cross-linking mass spectrometry to identify proximity relationships

These complementary approaches provide multidimensional insights into the assembly and organization of T4SS components.

How can genetic engineering of PtlG homologs enhance or modify T4SS functions?

Strategic engineering approaches include:

  • Domain Swapping: Exchanging domains between PtlG homologs from different species can alter substrate specificity or host range.

  • Directed Evolution: Creating libraries of PtlG variants and selecting for desired properties such as increased stability, altered specificity, or enhanced activity.

  • Rational Design: Structure-guided mutations to modify specific functional properties:

    Engineering GoalDesign StrategyAssessment Method
    Enhanced stabilityIntroducing disulfide bondsThermal shift assays
    Altered specificityModifying interaction surfacesBinding assays with various substrates
    Reduced immunogenicityRemoving immunogenic epitopesImmunological assays
    Controllable functionAdding regulatory domainsActivity assays under various conditions

This engineering approach could potentially modify the antagonistic properties of T4SS for specific research or therapeutic applications .

What are the evolutionary relationships between PtlG homologs across bacterial species?

Comparative genomic analysis reveals:

  • Functional Clusters: PtlG homologs cluster into distinct functional groups corresponding to T4SS subtypes (conjugation, effector translocation, DNA uptake).

  • Conservation Patterns:

    • Core structural domains show high conservation

    • Interface regions that mediate protein-protein interactions are moderately conserved

    • Species-specific regions show rapid evolution

  • Horizontal Gene Transfer: Evidence suggests frequent horizontal transfer of entire T4SS gene clusters, including ptlG homologs.

Methodological approaches include:

  • Phylogenetic analysis with maximum likelihood or Bayesian methods

  • Selection pressure analysis (dN/dS ratios) to identify adaptively evolving residues

  • Ancestral sequence reconstruction to trace evolutionary trajectories

  • Structural comparison of homologs to identify conserved functional elements

How can the antagonistic properties of T4SS be harnessed for potential therapeutic applications?

The discovery of T4SS-mediated bacterial antagonism opens novel therapeutic possibilities :

  • Targeted Antimicrobials:

    • Engineering bacteria expressing antagonistic T4SS to selectively eliminate pathogens

    • Development of narrow-spectrum antimicrobials targeting specific bacterial groups

    • Creation of self-limiting bacterial delivery systems for localized treatment

  • Microbiome Engineering:

    • Precise manipulation of complex bacterial communities

    • Elimination of specific pathogenic species while preserving beneficial flora

    • Restoration of dysbiotic communities to healthy states

  • Research Applications:

    ApplicationMethodologyPotential Impact
    Biocontrol agentsEngineered T4SS-expressing probioticsAlternative to antibiotics
    Diagnostic toolsT4SS-based bacterial sensorsPathogen detection systems
    Research reagentsControlled elimination of specific speciesDefined model communities

Methodological considerations include genetic containment strategies, delivery system development, and specificity enhancement through protein engineering.

What data analysis approaches are most effective for interpreting structural studies of PtlG and T4SS complexes?

Advanced computational methods enhance structural insights:

  • Integrative Structural Biology:

    • Combining data from multiple experimental techniques (cryo-EM, X-ray, NMR, mass spectrometry)

    • Computational modeling to fill missing regions

    • Molecular dynamics simulations to explore conformational dynamics

  • Network Analysis:

    • Protein interaction networks to understand system-level properties

    • Evolutionary coupling analysis to identify co-evolving residues

    • Functional module identification within the T4SS complex

  • Machine Learning Applications:

    • Prediction of protein-protein interaction interfaces

    • Classification of structural variants across species

    • Integration of structural and functional data for mechanistic insights

These computational approaches complement experimental methods and provide deeper mechanistic understanding of how PtlG functions within the T4SS complex, particularly in the context of recently discovered antagonistic properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.