Recombinant Typhonium venosum Alternative oxidase, mitochondrial (AOX1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
AOX1; Ubiquinol oxidase 1, mitochondrial; Alternative oxidase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
64-349
Protein Length
Full Length of Mature Protein
Species
Sauromatum venosum (Voodoo lily) (Typhonium venosum)
Target Names
Target Protein Sequence
ASTLSAPAQDGGKEKAAGTAGKVPPGEDGGAEKEAVVSYWAVPPSKVSKEDGSEWRWTCF RPWETYQADLSIDLHKHHVPTTILDKLALRTVKALRWPTDIFFQRRYACRAMMLETVAAV PGMVGGVLLHLKSLRRFEHSGGWIRALLEEAENERMHLMTFMEVAQPRWYERALVLAVQG VFFNAYFLGYLLSPKFAHRVVGYLEEEAIHSYTEFLKDIDSGAIQDCPAPAIALDYWRLP QGSTLRDVVTVVRADEAHHRDVNHFASDVHYQDLELKTTPAPLGYH
Uniprot No.

Target Background

Function
Recombinant *Typhonium venosum* Alternative oxidase, mitochondrial (AOX1) catalyzes the cyanide-resistant oxidation of ubiquinol and the reduction of molecular oxygen to water. Unlike cytochrome c oxidases, it does not translocate protons and is therefore not coupled to oxidative phosphorylation. AOX1 may enhance respiration when the cytochrome pathway is limited or under low-temperature conditions. In *S. guttatum*, the alternative respiratory pathway exhibits thermogenic properties.
Protein Families
Alternative oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Mitochondrial, possibly in the inner surface of the inner mitochondrial membrane.

Q&A

What is Typhonium venosum Alternative oxidase (AOX1)?

Alternative oxidase from Typhonium venosum (formerly known as Sauromatum guttatum or voodoo lily) is a mitochondrial terminal oxidase that catalyzes the four-electron reduction of oxygen to water. Unlike the cytochrome pathway, AOX bypasses respiratory complexes III and IV, allowing continued electron transport without proton pumping across the inner mitochondrial membrane . This protein is particularly notable as T. venosum is a thermogenic plant species that can generate significant heat during specific developmental stages, with AOX playing a crucial role in this process .

How should recombinant T. venosum AOX1 be stored and handled in laboratory settings?

For optimal stability and activity, recombinant T. venosum AOX1 protein should be stored at -20°C to -80°C. The shelf life is approximately 6 months for liquid formulations and 12 months for lyophilized formulations under these conditions . When working with the protein:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Avoid repeated freeze-thaw cycles that can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

What methods are used to express and purify recombinant T. venosum AOX1?

Recombinant T. venosum AOX1 is typically expressed in heterologous systems, with yeast being a common expression host . The general methodology involves:

  • Cloning and expression:

    • Amplify the AOX1 gene using PCR with primers designed from known sequences

    • Clone the PCR products into expression vectors (e.g., pGEMT vectors)

    • Transform into the expression host (e.g., yeast systems for T. venosum AOX1)

    • Induce protein expression under optimized conditions

  • Purification:

    • Harvest cells and disrupt membranes to release protein

    • Utilize affinity chromatography based on the tag incorporated (if any)

    • Further purify using ion exchange and/or size exclusion chromatography

    • Assess purity via SDS-PAGE (target purity >85%)

  • Quality control:

    • Verify protein identity via mass spectrometry or Western blotting

    • Confirm activity using enzymatic assays

    • Check for proper folding via circular dichroism or other structural analyses

How can researchers effectively measure AOX activity in vitro?

Measuring AOX activity requires specific methodologies to distinguish it from other respiratory pathways. Recommended approaches include:

  • Oxygen consumption measurements:

    • Use optical oxygen sensing technologies for broad timescale analysis and high-throughput potential

    • Measure oxygen consumption in the presence of cytochrome pathway inhibitors (e.g., cyanide, antimycin A)

    • Calculate AOX-specific activity as the difference between total respiration and inhibitor-resistant respiration

  • Spectrophotometric assays:

    • Monitor the oxidation of reduced ubiquinol analogs (e.g., ubiquinol-1) at 278 nm

    • Perform assays in the presence and absence of specific AOX inhibitors

    • Calculate activity based on kinetic parameters (Vmax and Km)

  • Inhibitor sensitivity analysis:

    • Test differential sensitivity to known AOX inhibitors including ascofuranone (AF), colletochlorin B (CB), octylgallate (OG), and salicylhydroxamic acid (SHAM)

What techniques are used to study AOX gene expression in Typhonium species?

Based on research with related Typhonium species, the following methods are effective for studying AOX gene expression:

  • PCR-based methods:

    • Design primers based on conserved regions identified through BLAST searches

    • Use degenerate primers for initial amplification if specific sequence information is limited

    • Test primers on cDNA generated from thermogenic tissues for best results

  • RT-qPCR for expression analysis:

    • Implement absolute quantification methods with standard curves

    • Normalize expression against housekeeping genes (e.g., ACTIN)

    • Use gene-specific primers to distinguish between AOX isoforms (e.g., AOX1a vs. AOX1b)

  • Cloning and sequencing:

    • Clone PCR products into appropriate vectors

    • Sequence to confirm identity and assemble complete sequences

    • Perform multiple sequence alignments to compare with AOX from other species

What is the role of AOX1 in thermogenesis in Typhonium venosum?

In thermogenic plants like Typhonium venosum, AOX1 plays a crucial role in heat production during specific developmental stages, particularly during flowering:

  • Mechanism of thermogenesis:

    • AOX catalyzes the oxidation of ubiquinol while bypassing proton pumping complexes

    • The energy typically used for ATP synthesis is instead released as heat

    • This process allows the plant to maintain elevated tissue temperatures (often 10-15°C above ambient)

  • Expression patterns:

    • Studies in related Typhonium species show high expression of AOX1 (both AOX1a and AOX1b isoforms) specifically in thermogenic tissues

    • Expression peaks during the thermogenic stage and is significantly higher in the appendix (the primary thermogenic tissue) compared to other floral parts

  • Functional significance:

    • Thermogenesis facilitates the volatilization of scent compounds that attract pollinators

    • In Typhonium species, this heat production is associated with specialized floral adaptations to attract saprophagous insects

How do inhibitors affect the activity of recombinant AOX proteins including T. venosum AOX1?

AOX proteins show differential sensitivity to various inhibitors, which is important for experimental design and functional studies:

InhibitorT. brucei AOX (rTAO)A. thaliana AOX1A (rAtAOX1A)Expected effect on T. venosum AOX1
Ascofuranone (AF)Most effectiveLess effective than CBLikely intermediate sensitivity
Colletochlorin B (CB)EffectiveMost effectiveLikely high sensitivity
Octylgallate (OG)Less effectiveLess effectiveLikely moderate sensitivity
Salicylhydroxamic acid (SHAM)Least effectiveLeast effectiveLikely least effective

The differential sensitivity appears to be related to differences in the mixture of polar residues lining the hydrophobic cavity of the enzyme, which affects inhibitor binding . When designing experiments with T. venosum AOX1, researchers should consider testing multiple inhibitors to determine the most effective compounds for their specific experimental conditions.

How can researchers design experiments to study the relationship between AOX expression and reactive oxygen species (ROS) production?

Based on findings that AOX may function to decrease ROS formation during respiratory electron transport, the following experimental approaches are recommended:

  • Transgenic approaches:

    • Generate cell lines or plant tissues with altered levels of T. venosum AOX1 expression

    • Create both overexpression and knockdown/knockout lines for comparative analysis

    • Use inducible expression systems to control AOX levels temporally

  • ROS measurement:

    • Utilize ROS-sensitive probes such as 2',7'-dichlorofluorescein diacetate for real-time measurement

    • Implement multiple complementary ROS detection methods (e.g., EPR spectroscopy, specific probes for different ROS species)

    • Correlate ROS levels with AOX expression and activity under various stress conditions

  • Experimental setups:

    • Examine ROS production under normal conditions versus stress conditions (e.g., temperature extremes, hypoxia, or chemical inhibitors of respiratory complexes)

    • Measure respiratory parameters simultaneously with ROS production

    • Assess downstream effects of altered ROS levels on cellular damage markers

What approaches can be used to study the structure-function relationship in T. venosum AOX1?

Understanding the structure-function relationship requires sophisticated molecular and biophysical approaches:

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignments

    • Focus on regions implicated in quinol binding, inhibitor sensitivity, and regulation

    • Generate mutant proteins and characterize their kinetic properties and inhibitor sensitivity

  • Computational approaches:

    • Perform Caver analysis to identify and characterize hydrophobic cavities

    • Use homology modeling based on known AOX structures

    • Implement molecular dynamics simulations to understand protein flexibility and substrate/inhibitor interactions

  • Biophysical characterization:

    • Apply circular dichroism spectroscopy to assess secondary structure

    • Use thermal shift assays to evaluate stability differences between wild-type and mutant proteins

    • Consider X-ray crystallography or cryo-EM approaches for detailed structural information

What potential applications exist for recombinant T. venosum AOX1 in broader research contexts?

The unique properties of AOX from thermogenic plants like T. venosum suggest several innovative research applications:

  • Metabolic engineering:

    • Introduction of T. venosum AOX1 into non-thermogenic plants to alter energy metabolism

    • Creation of synthetic energy-wasting pathways for biotechnological applications

    • Development of transgenic plants with enhanced stress tolerance

  • Comparative studies:

    • Investigation of evolutionary adaptations across thermogenic and non-thermogenic plant species

    • Examination of structural adaptations that enable high-flux electron transport

    • Understanding the molecular basis for tissue-specific thermogenesis

  • Biomedical research:

    • Exploration of AOX as a potential therapeutic target for mitochondrial disorders

    • Study of AOX-mediated ROS regulation as a model for oxidative stress responses

    • Investigation of alternative respiratory pathways as targets for pathogen control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.