Recombinant Tyramine receptor ser-2 (ser-2)

Shipped with Ice Packs
In Stock

Description

Signaling Mechanisms

Recombinant SER-2 expressed in HEK293 cells demonstrated dual signaling pathways:

  • cAMP Inhibition: Tyramine reduced cAMP by 80% via Gαᵢ/o coupling .

  • Calcium Mobilization: SER-2 triggered Ca²⁺ influx (EC₅₀ = 1.2 μM), while SER-2A showed weaker activity .

Antagonist profiling revealed:

AntagonistKi (nM)
LSD2.1
Yohimbine85
Chlorpromazine1,200

Source:

In Vivo Functional Roles

Genetic studies in C. elegans revealed SER-2’s roles in:

  • Pharyngeal Pumping: SER-2 antagonizes serotonin (5-HT)-stimulated pumping. ser-2 mutants failed to suppress 5-HT-induced pumping upon tyramine exposure .

  • Foraging Behavior: ser-2(pk1357) mutants exhibited defective nose-touch response during reversals, indicating SER-2 regulates sensorimotor integration .

  • Feeding Suppression: SER-2 in NSM neurons mediates tyramine/octopamine-dependent inhibition of feeding via 5-HT modulation .

Regulatory Mechanisms

Post-translational arginine methylation by PRMT-5 enhances SER-2 signaling:

  • Methylation Site: R¹⁹⁷ and R¹⁹⁹ in IL3 .

  • Functional Impact: PRMT-5 knockout reduced SER-2-mediated suppression of foraging by 60% .

Comparative Analysis with Insect Tyramine Receptors

While SER-2 is nematode-specific, insect TAR1 receptors share functional similarities:

ReceptorOrganismSignaling PathwayKey Function
SER-2C. elegansGαᵢ/o, Ca²⁺Pharyngeal pumping, foraging
TAR1DrosophilaGαᵢ/oOlfactory behavior
TAR2DrosophilaGαq, Ca²⁺Malpighian tubule function

Source:

Key Research Findings

  1. Isoform-Specific Pharmacology: SER-2A’s reduced octopamine sensitivity (vs. SER-2) highlights IL3’s role in ligand discrimination .

  2. Neural Circuit Integration: SER-2 in NSM neurons mediates cross-talk between tyraminergic and serotonergic pathways to regulate feeding .

  3. Methylation-Dependent Activation: PRMT-5-mediated methylation increases SER-2’s efficacy in vivo, linking epigenetic regulation to GPCR function .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ser-2; C02D4.2; Tyramine receptor Ser-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-455
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
ser-2
Target Protein Sequence
MFRNYTDSVQEMVLRAIDSIRDSVINASSAVSTTTLPPLDIPMTSMKPPSIIPTVELVLG TITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLA GGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIV IVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKI FISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRVGEKTPLVIADGQ TTVTTLAAHSTDGGSLPKDETTKHMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKIS VAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAKVEQAFTWLGYINSSLNP FLYGILNLEFRRAFKKILCPKAVLEQRRRRMSAQP
Uniprot No.

Target Background

Function
The Tyramine receptor (SER-2) is a G-protein coupled receptor for tyramine, a known neurotransmitter and neuromodulator and direct precursor of octopamine. The order of potency for this receptor is tyramine > octopamine > dopamine > serotonin > epinephrine = norepinephrine.
Gene References Into Functions
  1. Tyramine receptor (SER-2) isoforms play a role in regulating pharyngeal pumping and foraging behavior in the nematode Caenorhabditis elegans. PMID: 15569254
Database Links

KEGG: cel:CELE_C02D4.2

STRING: 6239.C02D4.2e

UniGene: Cel.9281

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
The different isoforms are expressed in specific, but overlapping sets of sensory, inter- and motor neurons, including AIY, AIZ and RIA interneurons. They are also expressed in pharyngeal cells, head muscles and excretory gland cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.