Recombinant Tyrosine-protein kinase etk (etk)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please specify it in your order for preferential development.
Synonyms
etk; Z1398; ECs1137; Tyrosine-protein kinase etk
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-726
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
etk
Target Protein Sequence
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADT LVQVEQKQGNAILSGLSDMIPNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPI VGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGENGHYTLEGEEFTVNGMVGQRL EKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSV DLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNK RVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPV KPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGAT PDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKV IQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVV GRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY SYSEKE
Uniprot No.

Target Background

Database Links

KEGG: ece:Z1398

STRING: 155864.Z1398

Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the difference between bacterial Etk and eukaryotic Etk/BMX?

While sharing the same name, these proteins represent distinct families. Bacterial Etk is a prokaryotic tyrosine kinase found in Escherichia coli and related bacteria, functioning as a membrane-associated protein involved in exopolysaccharide production and virulence mechanisms . It possesses a unique structure with no clear homology to eukaryotic tyrosine kinases . In contrast, eukaryotic Etk (also called BMX) belongs to the Tec family of non-receptor protein tyrosine kinases and is expressed in various hematopoietic, epithelial, and endothelial cells, playing roles in cellular proliferation, differentiation, and motility . The fold of the bacterial Etk kinase domain differs markedly from that of eukaryotic protein tyrosine kinases, suggesting independent evolutionary origins .

How does the activation mechanism of bacterial Etk differ from eukaryotic tyrosine kinases?

Bacterial Etk employs a unique two-step activation process that is fundamentally different from eukaryotic kinases. The crystal structure of the C-terminal kinase domain of E. coli Etk revealed that activation involves phosphorylation of tyrosine residue Y574, which then interacts with arginine residue R614 to unblock the active site . This represents a novel PTK activation mechanism where a single tyrosine residue in the active site undergoes a side-chain conformational change . In contrast, eukaryotic receptor tyrosine kinases (RTKs) require displacement of an entire activation loop by approximately 10 Å through phosphorylation of specific tyrosine residues before kinase activity can occur . The bacterial mechanism is much more localized, involving rearrangement of a single side chain rather than extensive conformational changes.

What are effective methods for purifying recombinant bacterial Etk for in vitro studies?

Bacterial Etk can be purified using affinity chromatography approaches. One validated method involves expressing recombinant His-tagged Etk in E. coli and purifying it using standard procedures . For phosphorylated Etk, researchers have successfully used agarose-conjugated anti-phosphotyrosine antibody (PT66) affinity chromatography from extracts of EPEC cultures at mid-logarithmic growth phase . Alternatively, Etk can be expressed with fusion tags such as GST and purified using glutathione beads columns . When expressing recombinant Etk, it's important to note that overexpression can be toxic to host bacteria, so using systems with regulated expression (such as adding the lacI gene to enable better regulation) is recommended . The purified protein should be stored appropriately, with evidence suggesting aliquoting and storage at -20°C/-80°C is effective, with glycerol added to a final concentration of 5-50% to prevent freeze-thaw damage .

How can Etk kinase activity be reliably measured in vitro?

Etk kinase activity can be assessed through several complementary approaches. A standard method involves in vitro kinase assays using [γ-³²P]ATP as a phosphate donor to measure autophosphorylation activity . Additionally, Etk's ability to phosphorylate exogenous substrates can be evaluated using synthetic co-polymers like poly(Glu:Tyr) or proteins such as enolase . For verification of tyrosine-specific phosphorylation, phosphoamino acid analysis can confirm that only tyrosine residues are phosphorylated . The specificity of tyrosine phosphorylation can be further validated by treating phosphorylated Etk with the tyrosine-specific protein phosphatase YopH, which should rapidly dephosphorylate the protein . Western blotting with anti-phosphotyrosine antibodies provides another approach to detect phosphorylated Etk in both in vitro reactions and cellular extracts .

What cell models are most appropriate for studying eukaryotic Etk/BMX function?

For studying eukaryotic Etk/BMX, several cellular models have been validated in the literature. Fibroblast-like synoviocytes (FLS) isolated from rheumatoid arthritis patients express Etk and have been used to study its role in inflammatory signaling pathways . For cancer research, prostate cancer cell lines that express Etk are suitable models to investigate its role in cellular transformation . The 293 cell line has been used successfully for co-expression studies examining the interaction between Etk and other signaling molecules such as v-Src . Additionally, the rat liver epithelial cell line WB, which contains endogenous Etk, has been employed to study the role of Etk in cellular transformation through dominant-negative approaches . When selecting a model system, researchers should consider that Etk is expressed in a variety of tissues including hematopoietic, epithelial, and endothelial cells, allowing for diverse experimental approaches depending on the specific research question .

How does bacterial Etk contribute to pathogenicity in E. coli?

Bacterial Etk plays a crucial role in virulence through its involvement in exopolysaccharide (EPS) production. Etk and its homologues in other bacterial pathogens form a distinct protein family of prokaryotic membrane-associated PTKs involved in EPS production, which is required for virulence . The pattern of Etk expression among pathogenic E. coli strains (EPEC, ETEC, and EHEC) but not in non-pathogenic laboratory strains strongly suggests its involvement in pathogenicity mechanisms . In vivo studies have demonstrated that etk-knockout E. coli cells exhibit compromised resistance to polymyxin-B, and complementation with functional Etk restores this resistance . The phosphorylation state of Etk changes during bacterial growth, with modifications occurring at late growth phases in pathogenic strains but not in K12 laboratory strains, indicating complex regulation of Etk in virulence-related processes .

What is the evidence linking eukaryotic Etk/BMX to cancer progression?

Multiple lines of evidence implicate eukaryotic Etk/BMX in cancer progression. Etk is expressed in various prostate cancer cell lines and tissues, suggesting a potential role in this malignancy . Mechanistically, Etk has been shown to be activated by v-Src, leading to increased kinase activity and subsequent activation of STAT3, a transcription factor known to promote oncogenesis . In cellular models, coexpression of v-Src and Etk leads to transphosphorylation on tyrosine 566 of Etk and subsequent autophosphorylation, correlating with substantially increased kinase activity . Further supporting its role in oncogenesis, expression of single-domain neutralizing intrabodies against Etk in transformed cells results in significant blockade of Etk enzymatic activity and inhibition of clonogenic cell growth in soft agar . These findings collectively indicate that Etk may play an important role in Src-induced cellular transformation and thus represents a potential target for cancer intervention .

What approaches show promise for targeting bacterial Etk for antimicrobial development?

The unique structure and activation mechanism of bacterial Etk present opportunities for selective antimicrobial targeting. Since Etk and its homologues define a distinct protein family involved in EPS production and virulence, they represent novel targets for antibiotic development . Structure-guided approaches based on the crystal structure of Etk's kinase domain could lead to small molecule inhibitors that specifically block the Y574-R614 interaction critical for Etk activation . Such inhibitors would theoretically compromise bacterial virulence by preventing EPS production without directly killing bacteria, potentially reducing selective pressure for resistance development. Additionally, the observed requirement of Etk for polymyxin-B resistance suggests that Etk inhibitors might sensitize pathogenic bacteria to existing antibiotics, enabling combination therapeutic strategies . The evolutionary distance between prokaryotic and eukaryotic tyrosine kinases would potentially allow for development of highly selective inhibitors with minimal cross-reactivity with human kinases .

What is the molecular mechanism of bacterial Etk activation involving Y574 phosphorylation?

The activation of bacterial Etk involves a unique molecular mechanism centered around tyrosine residue Y574. Crystal structure analysis at 2.5-Å resolution revealed that Y574 blocks the active site in the non-phosphorylated state . Upon phosphorylation, phospho-Y574 interacts specifically with arginine residue R614, causing a conformational change that unblocks the active site and allows ATP and substrate binding . This represents a novel switch mechanism where the side-chain conformational change of a single tyrosine residue in the active site controls kinase activity . Both in vitro kinase activity and in vivo polymyxin-B resistance studies using structure-guided mutants support this model: mutations that eliminate Y574 steric hindrance (Y574A), mimic constitutive activation (Y574E), or maintain wild-type-like P-Y574–R614 interaction (R614K) show higher activity than mutations that compromise this interaction (Y574F, Y574N, R614A) . Unlike eukaryotic kinases where activation involves substantial movements of entire activation loops, the bacterial Etk conformational change is much more localized, with the main-chain loop prior to Y574 remaining rigid due to hydrogen bonds to strand 3 and R614 .

How does eukaryotic Etk/BMX participate in cross-talk between signaling pathways?

Eukaryotic Etk/BMX functions as a key mediator in the cross-talk between different signaling pathways, particularly integrin/focal adhesion kinase (FAK) and toll-like receptor (TLR)/MyD88 pathways. Research using fibroblast-like synoviocytes has shown that Etk associates with multiple signaling proteins including MyD88, FAK, and Mal as demonstrated by co-immunoprecipitation studies . Knockdown of Etk using small interfering RNA significantly inhibits IL-6 synthesis in response to both LPS (a TLR4 ligand) and protein I/II (an activator of FAK), indicating its essential role in both pathways . Mechanistically, both LPS and protein I/II induce phosphorylation of Etk via a FAK-dependent pathway . This phosphorylation is critical for downstream signaling, as tyrosine phosphorylation on Y40 is required for Etk activation and subsequent signal transduction . The molecular interaction is further illuminated by the finding that activation of Etk is regulated by FAK through interaction between the pleckstrin homology (PH) domain of Etk and the FERM (protein 4.1 ezrin/radixin/moesin) domain of FAK . This positions Etk as a crucial integration point for inflammatory and adhesion signaling networks.

What are the identified substrates and binding partners of bacterial and eukaryotic Etk?

For bacterial Etk, potential physiological substrates include the E. coli protein BipA/TypA, which is tyrosine phosphorylated when expressed in EPEC but not in K12 strains . In vitro, BipA tyrosine phosphorylation is catalyzed by EPEC extracts but not by E. coli K12 extracts, suggesting Etk may be responsible .

For eukaryotic Etk/BMX, several interacting partners and substrates have been identified. Etk associates with MyD88, FAK, and Mal as demonstrated by co-immunoprecipitation studies in fibroblast-like synoviocytes . STAT3 has been shown to associate with Etk in vivo and is activated by Etk, potentially mediating some of Etk's effects on cellular transformation . In the context of integrin signaling, Etk interacts with FAK through its PH domain binding to the FERM domain of FAK, positioning Etk to mediate cross-talk between integrin and other signaling pathways . The activation of Etk by v-Src suggests a functional interaction between these proteins in cellular transformation contexts . These interactions position Etk as a signaling hub that integrates inputs from multiple pathways and influences diverse cellular processes.

How conserved is Etk across different bacterial species?

Bacterial Etk belongs to a family of prokaryotic membrane-associated protein tyrosine kinases with homologues in several bacterial species. Sequence analysis reveals that Etk is homologous to several bacterial proteins including the Ptk protein of Acinetobacter johnsonii, AmsA of the plant pathogen Erwinia amylovora, and Orf6 of the human pathogen Klebsiella pneumoniae . These proteins are involved in the production of exopolysaccharide required for virulence . Sequence alignment between members of the Etk/Wzc PTK family in both Gram-negative and Gram-positive bacteria, together with MinD ATPases, reveals clear sequence conservation over the central parallel strands, but not over the peripheral α-helices despite their similar spatial locations . Interestingly, Y574, which is critical for the activation mechanism in Gram-negative BY kinases like Etk, is not a conserved residue in Gram-positive BY kinases, suggesting a different kinase activation mechanism in these organisms . This divergence suggests that while the core catalytic function is conserved, regulatory mechanisms may have evolved differently across bacterial lineages.

How has research on bacterial Etk informed our understanding of prokaryotic signaling systems?

Research on bacterial Etk has significantly expanded our understanding of prokaryotic signaling systems in several ways. Firstly, it has challenged the long-held view that tyrosine phosphorylation is rare in bacteria, demonstrating that this post-translational modification is more common than previously appreciated . The discovery of Etk and similar bacterial tyrosine kinases has established a distinct protein family of prokaryotic membrane-associated PTKs involved in exopolysaccharide production and virulence . The elucidation of Etk's unique activation mechanism involving Y574 phosphorylation has revealed a novel regulatory strategy not seen in eukaryotic kinases, highlighting the diverse evolutionary solutions to enzyme regulation . Furthermore, the finding that Etk expression is regulated by specific environmental conditions (low pH, low magnesium) and potentially by two-component systems (similar to Wzc regulation by RcsABC) provides insights into how bacteria integrate environmental signals with virulence mechanisms . Collectively, these findings have enriched our understanding of bacterial signal transduction, demonstrating sophisticated regulatory mechanisms previously thought to be exclusive to eukaryotes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.