Recombinant Tyrosine-protein kinase ptk (ptk)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ptk; Tyrosine-protein kinase ptk
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-733
Protein Length
full length protein
Species
Acinetobacter johnsonii
Target Names
ptk
Target Protein Sequence
MYVMSQTTNTEDTIDLKELFFSLIAQWKLIALCIILSLICALLYLRATPDTYSVNALVQV EENKGASAALLGDLSSMIEQKQPAQAEIEILKSRLVLGNVIQHLNLDLKISGTENSFTDR LLSPHHYQTEYQPKSVLFKDDEKVFDIRQFNIPASFRDKKIELRFKDGQFSLTNTQTEQV ILTGKTNQSNTLRTADGLWNISIYTQDQLNDVYLIQKQSLPAAVNNILTNYSVAEKGKLT GILGLNYQGTDKTHITQVLNAILVSYSQQNIERRSAETAQTLKFLDEQLPELKQQLDVAE REFNKFRQQYNTVDVTKESELFLTQSVTLETQKAQLEQQVAEAGAKYTSEHPVMKQMNAQ LGAINKKIGELNATLKELPDLQRRYLQLYREVEVKQQLYTALLNSYQQLRIAKAGEIGNV RIVDTAVEPIEPIAPKKLQILILSIFLGGFLGTLLALLRNMMRSGIKDSTQIENELDLPV YATVPRSPVQESRINILKKKKNIPILAVKNSDDIAIESLRSMRTAIHFALSSARNNLITI SGPAPEVGKSFISTNLATILAQSDKRVLIIDADLRRGYLHKYFNLDTQPGLTELLNGQQS LETVIRHTEVPGLSVISRGKSPANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVTD GIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNGFILNDIQRSSAGYGYGYGY NYAYAYKANKESD
Uniprot No.

Target Background

Function
May be involved in exopolysaccharide production and transport.
Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the main types of PTKs and how do they differ structurally?

Protein tyrosine kinases are primarily classified into two categories:

Receptor Tyrosine Kinases (RTKs): These are transmembrane proteins that serve both as cell surface receptors and enzymes with kinase activity. RTKs possess:

  • A multidomain extracellular ligand-binding region

  • A single transmembrane hydrophobic helix

  • A cytoplasmic portion containing the tyrosine kinase domain

  • Regulatory sequences on both N- and C-terminal ends

Non-Receptor Tyrosine Kinases (NRTKs): These are cytoplasmic proteins that exhibit considerable structural variability. NRTKs contain:

  • A kinase domain

  • Additional signaling or protein-protein interaction domains (SH2, SH3, PTH domains)

  • No extracellular or transmembrane regions

The tyrosine kinase catalytic domain in both types spans approximately 300 amino acid residues and consists of:

  • An N-terminal lobe with a 5-stranded β sheet and one α helix

  • A C-terminal lobe that is predominantly α-helical

  • A cleft between the two lobes where ATP binds

  • A region in the C-terminal lobe that interacts with the tyrosine-containing sequence of substrate proteins

What expression systems are most effective for producing recombinant PTKs?

The choice of expression system significantly impacts the quality and activity of recombinant PTKs:

Baculovirus Expression System:

  • Most commonly used for producing active PTKs

  • Provides eukaryotic post-translational modifications

  • Yields properly folded, soluble, and active protein

  • Examples include recombinant SRC, JAK1, and PTK6 production

Escherichia coli Expression System:

  • Less expensive and faster than insect cell-based expression

  • Often faces challenges with host toxicity, kinase inactivity, insolubility, and heterogeneity

  • Can be optimized through specific strategies to overcome these limitations

Mammalian Cell Expression Systems:

  • HEK293T cells can be used for expressing complex PTKs

  • Provides proper folding and post-translational modifications

  • Used for producing recombinant PYK2 (PTK2B)

What are the essential components of a standard PTK activity assay?

A typical in vitro PTK activity assay requires the following components:

Basic Requirements:

  • Purified recombinant PTK

  • ATP (usually 100-200 μM)

  • Divalent cations (typically Mg²⁺ at 5-10 mM)

  • Appropriate buffer system (pH 7.0-7.5)

  • Substrate (peptide or protein containing tyrosine residues)

  • Detection system (antibodies, radioactivity, or fluorescence)

Example Reaction Conditions:
Using SRC kinase as an example:

  • 1 μM tyrosine kinase substrate

  • 1× Enzymatic Buffer

  • 5 mM MgCl₂

  • 1 mM DTT

  • 100 μM ATP

  • Incubation for 1 hour at room temperature

  • Detection using HTRF KinASE TK assay

How does substrate specificity differ among PTK families?

PTK families exhibit distinct substrate preferences based on sequence context around the phosphorylation site:

SRC Family Kinases:

  • Prefer substrates with acidic residues (Glu/Asp) at positions -4, -1, and +1 relative to the phosphorylated tyrosine

  • Often recognize sequences with hydrophobic residues at positions +3

JAK Family Kinases:

  • Phosphorylate STAT proteins (signal transducers and activators of transcription)

  • JAK1 mediates interferon-alpha/beta, interferon-gamma, and cytokine signaling

  • Contains a second phosphotransferase-related domain N-terminal to the PTK domain

Receptor Tyrosine Kinases:

  • EGFR family prefers substrates with hydrophobic residues at positions -1 and +1

  • PDGFR family shows preference for substrates with hydrophilic residues at position +1 and +3

What strategies can overcome the challenges in bacterial expression of active PTKs?

Producing active recombinant PTKs in bacterial systems presents several challenges that can be addressed through specific approaches:

Host Toxicity Solutions:

  • Use tightly controlled inducible promoters

  • Co-express chaperones or folding enhancers

  • Utilize specialized E. coli strains like BL21(DE3)pLysS or C41(DE3)

  • Lower growth temperature (16-20°C) to reduce kinase activity during expression

Insolubility Remediation:

  • Express as fusion proteins with solubility enhancers (MBP, SUMO, Thioredoxin)

  • Optimize induction conditions (lower IPTG concentration, lower temperature)

  • Co-express with phosphatases to counteract autophosphorylation

  • Utilize detergents or mild solubilization agents in purification buffers

Maintaining Kinase Activity:

  • Include ATP during purification to stabilize active conformation

  • Add protein stabilizers like glycerol, trehalose, or arginine

  • Maintain reducing environment to prevent oxidation of critical cysteine residues

  • Express specific domains rather than full-length protein when appropriate

Experimental data with SRC, Lyn, and FAK kinases demonstrates that addressing these issues can yield active PTKs from bacterial expression systems, providing a cost-effective alternative to insect cell expression .

How can researchers differentiate between true PTK inhibition and assay artifacts in screening campaigns?

When screening for PTK inhibitors, several methodological approaches can help distinguish genuine inhibition from artifactual results:

Control Experiments:

  • Perform kinase assays without ATP to establish baseline activity

  • Include negative control compounds with known non-inhibitory properties

  • Test compounds against multiple related and unrelated kinases to assess selectivity

  • Evaluate dose-response relationships across a wide concentration range

Secondary Validation Assays:

  • Use multiple detection methods (radiometric, fluorescence, antibody-based)

  • Confirm activity in cell-based assays that measure phosphorylation of endogenous substrates

  • Test for direct binding using biophysical methods (thermal shift, SPR, ITC)

  • Validate mechanism of action through enzyme kinetics (ATP-competitive vs. non-competitive)

Common Artifacts and Solutions:

  • Aggregation-based inhibition: include detergent (0.01% Triton X-100) in assay buffer

  • Fluorescence interference: use counterscreens without kinase to detect compound fluorescence

  • Redox cycling compounds: add catalase or DTT to prevent H₂O₂ generation

  • Metal chelators: vary metal ion concentration to detect chelation effects

What mechanisms contribute to acquired resistance against tyrosine kinase inhibitors in cancer therapy?

Acquired resistance to tyrosine kinase inhibitors (TKIs) occurs through multiple mechanisms that researchers must consider when developing new therapeutic strategies:

Genetic Alterations in Target PTKs:

  • Secondary mutations in the kinase domain (especially gatekeeper mutations)

  • Gene amplification leading to overexpression of the target PTK

  • Alternative splicing generating isoforms with altered drug sensitivity

Activation of Bypass Signaling Pathways:

  • Upregulation of alternative RTKs that compensate for the inhibited pathway

  • Activation of downstream effectors that bypass the need for the targeted PTK

  • Crosstalk between parallel signaling networks

Pharmacological Limitations:

  • Altered drug metabolism affecting TKI concentration

  • Increased drug efflux via ABC transporters

  • Decreased drug influx transporters

Tumor Microenvironment Factors:

  • Paracrine growth factor production by stromal cells

  • Hypoxia-induced changes in signaling dependencies

  • Altered extracellular matrix interactions

A comprehensive table of TKIs, their targets, and clinical applications is presented below, highlighting the importance of understanding resistance mechanisms:

TKITargetApplication of Disease
ImatinibAbl, PDGFR, SCFRCML, GIST
GefitinibEGFRNSCLC
NilotinibBcr-Abl, PDGFRCML
SorafenibRaf, VEGFR, PDGERAdvanced RCC
SunitinibPDGFR, VEGFRGIST, Advanced RCC
DasatinibBcr-Abl, SRC, PDGFRCML
OsimertinibEGFRNSCLC
AlectinibALKNSCLC

These TKIs have become standard treatments, but resistance ultimately limits their effectiveness, with a median response duration of only 5-9 months in many cases .

How can protein-protein interactions between PTKs and their substrates be effectively studied?

Understanding PTK-substrate interactions requires specialized techniques to capture these often transient associations:

In Vitro Binding Assays:

  • Far Western blot analysis to detect direct binding between purified recombinant PTK and substrate proteins

  • In vitro kinase assays using purified components to establish enzyme-substrate relationships

  • Phosphoamino acid analysis to confirm tyrosine-specific phosphorylation

Heterologous Expression Systems:

  • Baculovirus expression systems for co-expression of PTK and substrate

  • Analysis of physical association through co-immunoprecipitation

  • Evaluation of substrate phosphorylation status with phospho-specific antibodies

Cell-Based Approaches:

  • Proximity ligation assays to detect PTK-substrate interactions in intact cells

  • FRET/BRET-based assays to monitor real-time interactions

  • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Interactome profiling methods like RIME (Rapid Immunoprecipitation Mass spectrometry of Endogenous proteins)

Example of SYK-STAT3 Interaction Study:
Research has demonstrated that STAT3 is a substrate of SYK tyrosine kinase in B-lineage lymphoid cells. The interaction was characterized through:

  • In vitro binding assays showing concentration-dependent binding

  • Kinase assays confirming SYK-mediated phosphorylation of STAT3

  • Phosphoamino acid analysis proving tyrosine-specific modification

  • Baculovirus co-expression validating the interaction in a cellular context

  • Analysis of DNA binding activity to confirm functional consequences

What role does PTK7 play in cancer and how can it be targeted for immunotherapy?

Recent research has identified Protein Tyrosine Kinase 7 (PTK7) as a promising target for cancer immunotherapy, particularly in neuroblastoma:

PTK7 Characteristics and Function:

  • PTK7 is a pseudo tyrosine kinase that lacks catalytic activity

  • Involved in both canonical and non-canonical Wnt signaling pathways

  • Plays a role in tumor initiation and invasion in multiple cancer types

  • Remains stably expressed on cancer cells even after chemotherapy treatment

Expression Pattern in Cancer:

  • Abundantly expressed on neuroblastoma cell surfaces

  • Maintains expression following chemotherapy, unlike some other surface markers

  • Shows minimal expression in healthy pediatric tissues, offering a therapeutic window

  • Expression confirmed in patient tumor biopsies before and after chemotherapy

Immunotherapeutic Approaches:

  • Development of anti-PTK7 chimeric antigen receptor (CAR) T cells

  • CAR T cells demonstrate antigen-specific cytotoxicity against PTK7-expressing neuroblastoma

  • Preclinical models show regression of metastatic neuroblastoma in mice

  • Potential alternative to GD2-targeting approaches currently used clinically

Functional Studies:

  • CRISPR-Cas9 knockout models used to evaluate PTK7's role in neuroblastoma

  • T cell activation assays showing specific response to PTK7-positive tumor cells

  • In vivo models demonstrating efficacy and safety of PTK7-targeted therapy

What experimental considerations are critical when designing in vitro PTK activity assays?

Designing robust PTK activity assays requires careful attention to multiple experimental parameters:

Protein Quality Control:

  • Verify protein purity (>80% by SDS-PAGE)

  • Confirm proper folding through activity benchmarking

  • Assess batch-to-batch consistency with standard substrates

  • Document storage conditions and stability (avoid repeated freeze-thaw cycles)

Assay Optimization:

  • Determine optimal kinase concentration through titration experiments

  • Establish linear range for both substrate concentration and reaction time

  • Optimize ATP concentration (typically 50-200 μM for most PTKs)

  • Validate signal-to-background ratio (>3:1 for reliable measurements)

Key Reaction Components:

  • Buffer composition (pH 7.0-7.5, ionic strength)

  • Divalent cation type and concentration (Mg²⁺ vs. Mn²⁺)

  • Reducing agents (DTT or β-mercaptoethanol)

  • Additives for stability (glycerol, BSA)

  • Detergents to prevent aggregation (0.01% Triton X-100)

Controls and Validation:

  • Include no-enzyme control to measure background phosphorylation

  • Use no-ATP control to confirm ATP dependency

  • Include positive control inhibitor of known potency

  • Verify that phosphorylation increases linearly with time under chosen conditions

Example Protocol Flow for PTK Assay:

  • Array preparation and blocking (for microarray-based assays)

  • Preparation of basic mix (buffer, salts, detection antibodies)

  • Preparation of total mix with ATP just prior to reaction initiation

  • Kinase reaction (typically 60-90 minutes)

  • Detection using appropriate method (fluorescence, luminescence, radioactivity)

  • Data analysis accounting for background and normalization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.