Recombinant Tyrosine-protein kinase wzc (wzc)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
wzc; STY2329; t0756; Tyrosine-protein kinase wzc
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Salmonella typhi
Target Names
wzc
Target Protein Sequence
MTEKVKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADAL VQIEQNAGNSLVQDINSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLF GAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKRYQLVSDGGFSAQGVVGQPLN KDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLNLTFTGEDRDQ IRDILNSITRNYLQQDIAWKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVD LPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKGLEDKKAKLNGR VTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGNVRIVDPAITQPGVLK PKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSSSIGKT FVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAI ANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHVGT TLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
Uniprot No.

Target Background

Function
Essential for extracellular polysaccharide colanic acid synthesis. The autophosphorylated form is inactive. Likely involved in the export of colanic acid from the cell to the surrounding medium.
Database Links

KEGG: stt:t0756

STRING: 220341.STY2329

Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Tyrosine-protein kinase Wzc and what is its primary function in bacteria?

Tyrosine-protein kinase Wzc is a bacterial protein with autophosphorylating kinase activity, essential for the synthesis and export of exopolysaccharides (EPS) in various bacterial species. It functions exclusively through phosphorylation on tyrosine residues, in contrast to most bacterial kinases that target serine/threonine residues. Wzc plays a critical role in the assembly of capsular polysaccharides, which are important virulence factors in many pathogenic bacteria .

Methodologically, researchers can confirm Wzc's tyrosine kinase activity by:

  • Overexpressing the protein from its specific gene

  • Purifying it using affinity chromatography

  • Incubating it with radioactive ATP

  • Performing two-dimensional analysis of phosphoamino acid content

  • Verifying modification occurs exclusively at tyrosine residues

What is the molecular structure of Wzc and how does it relate to its function?

Wzc consists of two main structural domains:

  • N-terminal domain: Contains two transmembrane α-helices that anchor the protein to the bacterial membrane

  • C-terminal cytoplasmic domain: Harbors the protein-tyrosine kinase activity and contains the phosphorylation sites

Recent cryo-electron microscopy studies have revealed that dephosphorylated Wzc forms an octameric assembly with a large central cavity formed by transmembrane helices . This structural arrangement is critical for its function in capsule assembly and export.

The C-terminal domain contains six distinct phosphorylation sites:

  • Five sites form a tyrosine cluster at the C-terminal end (Tyr708, Tyr710, Tyr711, Tyr713, and Tyr715)

  • One site (Tyr569) is located upstream of this cluster

How does Wzc interact with the phosphatase Wzb and what is the significance of this interaction?

Wzc and Wzb form a regulatory pair with opposing activities:

  • Wzc autophosphorylates on tyrosine residues

  • Wzb functions as a phosphotyrosine-protein phosphatase capable of dephosphorylating Wzc

This interaction creates a reversible protein phosphorylation system that regulates exopolysaccharide production. When Wzb dephosphorylates Wzc, it alters Wzc's activity, demonstrating that Wzc serves as an endogenous substrate for Wzb. Experimental verification of this interaction involves:

  • Radioactively labeling purified Wzc with [γ-32P]ATP

  • Incubating the labeled Wzc with purified Wzb

  • Measuring the decrease in Wzc phosphorylation over time

This regulatory mechanism appears to be conserved across different bacterial species, as cross-reactivity experiments have shown that Wzb from E. coli can dephosphorylate Ptk from A. johnsonii, and conversely, Ptp from A. johnsonii can dephosphorylate Wzc from E. coli .

What is the detailed mechanism of Wzc autophosphorylation and how can it be experimentally characterized?

Wzc employs a sophisticated cooperative two-step mechanism for autophosphorylation involving both intramolecular and intermolecular processes:

Step 1 (Intramolecular): Tyr569 autophosphorylates through an intramolecular process.
Step 2 (Intermolecular): Phosphorylation of Tyr569 increases the protein kinase activity of Wzc, which then phosphorylates the five terminal tyrosines (Tyr708, Tyr710, Tyr711, Tyr713, and Tyr715) through an intermolecular process .

Experimental approaches to characterize this mechanism:

  • Domain separation studies: Express and purify the N-terminal and C-terminal domains separately to determine their individual phosphorylation capabilities

  • Site-directed mutagenesis: Create point mutations at specific tyrosine residues to identify their roles in the phosphorylation cascade

  • In vitro phosphorylation assays: Use radioactive ATP ([γ-32P]ATP) to track phosphorylation events

  • Phosphopeptide mapping: Identify specific phosphorylation sites using mass spectrometry following tryptic digestion

What experimental designs are most effective for studying the role of Wzc in exopolysaccharide production?

An effective experimental design for studying Wzc's role in exopolysaccharide production should incorporate several complementary approaches:

Table 1: Recommended Experimental Design Components

ApproachMethodologyExpected Outcome
Gene knockout studiesGenerate Δwzc mutants and analyze EPS productionEstablishes causality between Wzc and EPS production
Complementation assaysReintroduce wild-type or mutant wzc genes into knockout strainsConfirms specific domains/residues required for function
Phosphorylation state manipulationExpress phosphomimetic (Y→E) or phosphodeficient (Y→F) mutantsDetermines the role of specific phosphorylation events
Structural analysisCryo-EM or X-ray crystallography of Wzc in different phosphorylation statesReveals conformational changes associated with function
Protein-protein interaction studiesCo-immunoprecipitation or bacterial two-hybrid assaysIdentifies protein partners in the EPS assembly machinery

Studies in cyanobacteria have demonstrated that Δwzc (Δsll0923) mutants show altered amounts and composition of both capsular polysaccharides (CPS) and released polysaccharides (RPS), confirming Wzc's central role in EPS production .

How do the structural features of Wzc compare to other bacterial exopolysaccharide regulators?

Structural comparisons between Wzc and related proteins like Wzz reveal important similarities and differences:

  • Similarities:

    • Both Wzc and Wzz form oligomeric assemblies

    • They share an open arrangement of transmembrane helices

    • Both contain a periplasmic ring formed by motif 1

  • Key differences:

    • Wzz lacks the kinase domain and periplasmic motif 2 present in Wzc

    • In Wzz, motif 3 is replaced by an extended helical bundle with a very different arrangement

    • The helical barrel evident in the Wzz octamer is not found in Wzc

    • The interfaces between motif 1 in Wzz bury approximately twice as much surface area as the corresponding motif in Wzc

These structural differences likely reflect the distinct functional roles of these proteins in polysaccharide synthesis and export pathways.

What approaches can be used to study Wzc phosphorylation dynamics in vivo?

Studying Wzc phosphorylation dynamics in living bacteria requires specialized methodologies:

  • Phosphospecific antibody development: Generate antibodies that specifically recognize phosphorylated Wzc to track phosphorylation states in vivo

  • Fluorescence resonance energy transfer (FRET)-based biosensors: Create fusion proteins combining Wzc with fluorescent proteins to monitor conformational changes associated with phosphorylation

  • Inducible expression systems: Use controllable promoters to manipulate Wzc expression levels and study the effects on phosphorylation patterns

  • Time-course experiments: Monitor changes in Wzc phosphorylation over time in response to environmental stimuli using immunoblotting with anti-phosphotyrosine antibodies

  • Mass spectrometry-based phosphoproteomics: Quantify changes in the phosphorylation of individual tyrosine residues in Wzc under different conditions

Western blot analysis using anti-phosphotyrosine antibodies has successfully demonstrated ATP-dependent increases in Wzc phosphorylation levels over time .

What are the optimal methods for recombinant expression and purification of Wzc for in vitro studies?

The successful expression and purification of functional Wzc requires careful consideration of several factors:

Expression system optimization:

  • E. coli expression systems: BL21(DE3) strains with tightly regulated promoters (T7 or tac) are preferred

  • Expression plasmids: pET series vectors with affinity tags (His6 or GST) facilitate purification

  • Induction conditions: Lower temperatures (16-18°C) and reduced IPTG concentrations (0.1-0.5 mM) improve proper folding

  • Domain-specific constructs: Express full-length Wzc, C-terminal domain, or N-terminal domain separately depending on experimental goals

Purification strategy:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged constructs)

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography to obtain homogeneous protein preparation

  • Include detergents (0.1% DDM or 1% CHAPS) when purifying full-length Wzc to maintain membrane domain solubility

The most successful approach demonstrated in the literature involves overproducing Wzc from its specific gene and purifying to homogeneity by affinity chromatography .

How can researchers design effective experiments to study the effect of Wzc phosphorylation on bacterial capsule assembly?

A comprehensive experimental design should include:

  • Generation of phosphorylation-state mutants:

    • Phosphomimetic mutants (Y→E) to simulate constitutive phosphorylation

    • Phosphodeficient mutants (Y→F) to prevent phosphorylation

    • Focus on key residues: Tyr569 and the tyrosine cluster (Tyr708, Tyr710, Tyr711, Tyr713, Tyr715)

  • Phenotypic characterization:

    • Quantify capsule production using uronic acid assays or alcian blue staining

    • Assess bacterial colony morphology

    • Analyze capsule structure using electron microscopy

  • Molecular analysis:

    • Monitor Wzc oligomerization state using chemical crosslinking or native PAGE

    • Examine protein-protein interactions with other capsule synthesis machinery components

    • Track subcellular localization of Wzc using fluorescence microscopy

  • Structural studies:

    • Compare structures of wild-type and mutant Wzc proteins

    • Analyze the octameric assembly formation in different phosphorylation states

  • Control variables:

    • Growth conditions (temperature, media composition)

    • Bacterial growth phase

    • Expression levels of Wzc and Wzb

What bioinformatic approaches can identify new Wzc-like bacterial tyrosine kinases in genome sequences?

Identifying novel Wzc-like bacterial tyrosine kinases (BY-kinases) in genomic data requires sophisticated bioinformatic strategies:

  • Sequence-based approaches:

    • Profile hidden Markov models (HMMs) built from known BY-kinase sequences

    • Position-specific scoring matrices (PSSMs) for conserved Walker A and B motifs

    • Analysis of C-terminal tyrosine-rich clusters characteristic of BY-kinases

  • Structural prediction:

    • Threading algorithms to identify proteins with similar predicted 3D structures

    • Analysis of predicted transmembrane domains coupled with cytoplasmic kinase domains

  • Genomic context analysis:

    • Identification of genes located within exopolysaccharide synthesis loci

    • Co-occurrence patterns with phosphatase genes (Wzb homologs)

    • Prediction of operons containing capsule synthesis genes

  • Phylogenetic analysis:

    • Construction of evolutionary trees to identify divergent BY-kinase families

    • Comparison with known BY-kinases (Wzc, Etk, AmsA, ExoP, CpsD)

Using these approaches, researchers have successfully identified BY-kinases across diverse bacterial species, all showing homology with membrane proteins containing Walker A and B ATP/GTP-binding motifs encoded by genes in exopolysaccharide synthesis loci .

How can understanding Wzc function contribute to novel antimicrobial strategies?

The critical role of Wzc in bacterial capsule assembly presents several opportunities for antimicrobial development:

  • Direct inhibition strategies:

    • Small molecule inhibitors targeting the ATP-binding site of Wzc

    • Peptide inhibitors designed to disrupt Wzc oligomerization

    • Compounds that lock Wzc in either phosphorylated or dephosphorylated states

  • Attenuating bacterial virulence:

    • Since exopolysaccharides are important virulence factors, Wzc inhibitors could reduce pathogenicity without killing bacteria, potentially reducing selection pressure for resistance

    • Such anti-virulence approaches may be less likely to promote antimicrobial resistance

  • Combinatorial approaches:

    • Using Wzc inhibitors to increase bacterial susceptibility to conventional antibiotics by reducing capsule protection

    • Developing dual-target inhibitors affecting both Wzc and other capsule synthesis proteins

  • Structure-based drug design:

    • Utilizing the octameric Wzc structure to design inhibitors that disrupt the assembly

    • Targeting the unique tyrosine cluster region with specific inhibitors

Research in cyanobacteria suggests that targeting the Wzc/Wzb system could affect both capsular (CPS) and released polysaccharides (RPS), potentially disrupting biofilm formation and host colonization .

What are the most significant methodological challenges in studying Wzc function and how can they be addressed?

Researchers face several key challenges when studying Wzc:

Table 2: Methodological Challenges and Solutions

ChallengeDescriptionPotential Solutions
Membrane protein purificationFull-length Wzc contains transmembrane domains, making it difficult to purify in active formUse detergent optimization screens; express soluble domains separately; employ nanodiscs or amphipols to stabilize membrane domains
Dynamic phosphorylation statesWzc exists in multiple phosphorylation states in vivo, complicating analysisDevelop phospho-specific antibodies; use mass spectrometry to quantify site-specific phosphorylation; create phosphomimetic mutants
Oligomeric assemblyWzc forms octameric complexes that may be unstable during purificationUse mild crosslinking; employ native mass spectrometry; analyze by cryo-EM rather than X-ray crystallography
Functional redundancySome bacteria have multiple BY-kinases with overlapping functionsGenerate multiple gene knockouts; use conditional expression systems; perform complementation assays with heterologous BY-kinases
In vivo relevanceConnecting in vitro phosphorylation to in vivo function can be challengingDevelop biosensors to monitor phosphorylation in vivo; create knock-in strains expressing tagged versions of Wzc; perform infection models with mutant strains

How does the Wzc phosphorylation mechanism compare with eukaryotic tyrosine kinases, and what are the evolutionary implications?

The discovery of bacterial tyrosine kinases like Wzc provides fascinating insights into the evolution of protein phosphorylation systems:

  • Mechanistic differences:

    • Wzc utilizes a unique two-step mechanism involving both intramolecular and intermolecular phosphorylation events

    • Unlike eukaryotic tyrosine kinases, Wzc lacks an SH2 domain for recognizing phosphotyrosine

    • Wzc contains a distinctive C-terminal tyrosine cluster not found in eukaryotic kinases

  • Structural distinctions:

    • Eukaryotic tyrosine kinases typically have a bilobal catalytic domain structure

    • Wzc forms unusual octameric assemblies with a central cavity

    • The ATP-binding site in Wzc features Walker A and B motifs rather than the canonical kinase motifs found in eukaryotes

  • Evolutionary considerations:

    • BY-kinases like Wzc represent a case of convergent evolution, developing tyrosine kinase activity independently from eukaryotic systems

    • The coupling of Wzc with the low molecular weight phosphatase Wzb suggests an ancient regulatory system predating eukaryotic tyrosine kinase signaling

    • The presence of Wzc homologs across diverse bacterial species indicates horizontal gene transfer and functional conservation

These findings challenge the traditional view that tyrosine phosphorylation evolved exclusively in eukaryotes and suggest that bacteria developed this regulatory mechanism independently for controlling exopolysaccharide production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.