Recombinant Ubiquinol-cytochrome c reductase iron-sulfur subunit (qcrA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-429
Protein Length
full length protein
Target Names
qcrA
Target Protein Sequence
MSRADDDAVGVPPTCGGRSDEEERRIVPGPNPQDGAKDGAKATAVPREPDEAALAAMSNQ ELLALGGKLDGVRIAYKEPRWPVEGTKAEKRAERSVAVWLLLGGVFGLALLLIFLFWPWE FKAADGESDFIYSLTTPLYGLTFGLSILSIAIGAVLYQKRFIPEEISIQERHDGASREID RKTVVANLTDAFEGSTIRRRKLIGLSFGVGMGAFGLGTLVAFAGGLIKNPWKPVVPTAEG KKAVLWTSGWTPRYQGETIYLARATGTEDGPPFIKMRPEDMDAGGMETVFPWRESDGDGT TVESHHKLQEIAMGIRNPVMLIRIKPSDLGRVVKRKGQESFNFGEFFAFTKVCSHLGCPS SLYEQQSYRILCPCHQSQFDALHFAKPIFGPAARALAQLPITIDTDGYLVANGDFVEPVG PAFWERTTT
Uniprot No.

Q&A

What is Ubiquinol-Cytochrome C Reductase and its role in cellular metabolism?

Ubiquinol-Cytochrome C Reductase, commonly referred to as Complex III, functions as a critical component in the electron transport chain (ETC), playing an essential role in oxidative phosphorylation and ATP production. This multisubunit transmembrane protein complex is encoded by both mitochondrial and nuclear genomes. It is ubiquitously present in eukaryotes, in the internal membranes of most eubacteria, and within the mitochondria of all animals . Within the respiratory chain, Complex III typically serves as the third element, facilitating electron transfer from ubiquinol to cytochrome c while simultaneously pumping protons across the membrane to generate the electrochemical gradient necessary for ATP synthesis.

How does the QcrA subunit contribute to the function of Ubiquinol-Cytochrome C Reductase?

The QcrA subunit, also known as the Rieske iron-sulfur protein, is a critical functional component of the cytochrome bc complex. It contains an iron-sulfur cluster that plays a fundamental role in electron transfer during respiration. The importance of QcrA can be observed in research showing that mutations in this subunit (such as Leu356Val) can significantly alter the functionality of the entire cytochrome bc complex . Specifically, QcrA participates in the formation of the quinol oxidation (Qp) site at the interface with the QcrB subunit, creating a crucial functional domain for the enzyme's catalytic activity. The iron-sulfur cluster within QcrA accepts electrons from ubiquinol and transfers them to cytochrome c, making it an indispensable component in the electron transport process.

What are the structural characteristics of QcrA and how do they relate to its function?

QcrA's structure comprises a domain containing a [2Fe-2S] cluster positioned at the interface with the QcrB subunit. Based on structural modeling from Mycobacterium smegmatis (PDB code 6HW6), the QcrA subunit forms part of the quinol oxidation (Qp) site . This strategic positioning enables QcrA to participate directly in electron transfer processes. The protein's tertiary structure facilitates its interaction with both the membrane domain and other subunits of the complex. Mutations in key residues, particularly those at the Qp site interface (such as Leu356), can significantly alter binding capacity for various inhibitors, suggesting these residues are critical for maintaining proper protein conformation and interaction with substrates and inhibitors.

How do mutations in QcrA affect susceptibility to respiratory chain inhibitors in mycobacteria?

Research has identified that specific mutations in QcrA can confer resistance to multiple respiratory chain inhibitors. For instance, the mutation Leu356Val in QcrA (identified in strain QuinR-M1) confers resistance to quinazoline derivatives and causes cross-resistance to other QcrB inhibitors including Q203, AX-35, and lansoprazole sulfide (LPZs) . This resistance pattern is particularly noteworthy as it represents the first documented case of cross-resistance involving QcrA mutations. Recombineering experiments confirmed that this specific mutation in QcrA is directly responsible for the observed resistance. The mechanism likely involves structural alterations at the quinol oxidation (Qp) site, which is formed at the interface of QcrA and QcrB subunits. These alterations appear to prevent inhibitor binding while maintaining sufficient electron transport functionality for bacterial survival.

What experimental approaches are most effective for studying QcrA-mediated drug resistance mechanisms?

The most effective experimental approaches for investigating QcrA-mediated drug resistance include:

  • Selective Pressure Mutation Generation: Exposing susceptible bacterial strains (e.g., M. tuberculosis H37Rv) to increasing concentrations of target compounds (such as quinazoline derivatives) to select for resistant mutants .

  • Whole Genome Sequencing (WGS): Analyzing resistant mutants to identify genetic alterations associated with resistance, particularly within respiratory chain components.

  • Recombineering Validation: Creating specific mutations in susceptible strains to confirm the role of identified mutations in conferring resistance. This approach proved effective in validating the role of the QcrA(L356V) mutation in quinazoline derivative resistance .

  • Minimum Inhibitory Concentration (MIC) Assays: Determining changes in susceptibility profiles through standardized methodologies like the Resazurin Microtiter Assay (REMA).

  • Cross-Resistance Profiling: Testing resistant mutants against diverse respiratory chain inhibitors to understand resistance mechanisms and potential structural relationships between binding sites.

  • Oxygen Consumption Rate (OCR) Measurements: Utilizing real-time bioenergetic profiling to assess the functional impact of mutations and inhibitor binding on respiratory chain activity .

How does QcrA interact with other subunits of the cytochrome bc complex, and what implications does this have for drug discovery?

QcrA interacts closely with the QcrB subunit to form the quinol oxidation (Qp) site at their interface, creating a crucial functional domain targeted by multiple respiratory inhibitors . Structural modeling based on Mycobacterium smegmatis cytochrome bc complex (PDB code 6HW6) reveals that resistance mutations map specifically to this Qp site. The implications for drug discovery are significant:

  • Multi-Subunit Targeting Opportunity: The discovery that resistance can emerge through mutations in either QcrA or QcrB suggests that designing inhibitors that simultaneously engage both subunits could potentially reduce resistance development.

  • Resistance Prediction: Understanding the structural interplay between these subunits allows for the prediction of potential resistance mutations, which can inform rational drug design to circumvent resistance.

  • Novel Binding Sites: The interface between QcrA and QcrB may contain additional druggable pockets beyond the classical stigmatellin pocket frequently targeted by current inhibitors.

  • Combinatorial Approaches: The cross-resistance patterns observed between different chemical classes of inhibitors (quinazolines, Q203, AX-35, LPZs) suggest potential for developing combination therapies targeting different aspects of the complex .

What techniques are recommended for expressing and purifying recombinant QcrA for structural and functional studies?

For successful expression and purification of recombinant QcrA, researchers should consider the following methodological approach:

  • Expression System Selection:

    • Bacterial expression systems (particularly E. coli BL21(DE3)) are suitable for QcrA expression when the iron-sulfur cluster assembly is not critical

    • For properly assembled iron-sulfur clusters, consider using specialized strains with enhanced capacity for Fe-S cluster incorporation, such as E. coli SHuffle or systems co-expressing iron-sulfur cluster assembly proteins

  • Vector Design:

    • Include a cleavable affinity tag (His6 or Strep-tag) for purification

    • Optimize codon usage for the expression host

    • Consider fusion partners (such as MBP or SUMO) to enhance solubility

  • Culture Conditions:

    • Supplement media with iron and sulfur sources (ferric ammonium citrate and cysteine)

    • Use low-temperature induction (16-18°C) to enhance proper folding

    • Consider anaerobic or microaerobic conditions to protect iron-sulfur clusters

  • Purification Protocol:

    • Perform all purification steps under reduced oxygen conditions or with reducing agents

    • Use affinity chromatography followed by size exclusion chromatography

    • Include stabilizing agents like glycerol (10-15%) in all buffers

    • Consider detergent selection carefully if membrane-associated forms are required

  • Quality Control:

    • Verify iron-sulfur cluster incorporation through UV-visible spectroscopy

    • Assess protein purity via SDS-PAGE and protein functionality through electron transfer activity assays

How can researchers effectively design experiments to study QcrA mutations and their impact on antimicrobial resistance?

Designing robust experiments to investigate QcrA mutations requires a systematic approach:

  • Mutation Identification Strategy:

    • Generate resistant mutants through exposure to increasing concentrations of inhibitors (e.g., 5-20X MIC for compounds like quinazoline derivatives)

    • Perform whole-genome sequencing to identify potential resistance mutations

    • Create a database of mutations across different inhibitor classes to identify patterns

  • Validation of Causative Mutations:

    • Employ recombineering to introduce specific mutations into wild-type strains

    • Use CRISPR-Cas9-based genome editing for precise modification

    • Compare MIC values between wild-type and mutant strains to confirm resistance phenotypes

  • Functional Characterization:

    • Measure oxygen consumption rates in real-time using platforms like Seahorse XF Analyzer

    • Assess ATP production levels in wild-type versus mutant strains

    • Monitor membrane potential changes using appropriate fluorescent probes

  • Cross-Resistance Profiling:

    • Test mutants against diverse respiratory inhibitors (Q203, AX-35, LPZs, etc.)

    • Create comprehensive resistance matrices to visualize patterns

    • Quantify resistance levels through fold-change in MIC values

  • Gene Expression Analysis:

    • Perform qRT-PCR to measure expression changes in related genes (e.g., cydB, lipU)

    • Compare expression patterns between resistant mutants and wild-type strains

    • Analyze both basal expression and changes upon inhibitor exposure

  • Data Analysis Framework:

    • Establish clear definitions for resistance (e.g., >3-fold MIC increase)

    • Use appropriate statistical methods to determine significance

    • Consider multiple biological replicates to ensure reproducibility

What assays are most appropriate for evaluating the electron transport function of wild-type versus mutant QcrA proteins?

To effectively assess electron transport function in wild-type versus mutant QcrA proteins, researchers should consider these methodologically robust assays:

  • Oxygen Consumption Rate (OCR) Measurement:

    • Real-time measurement using polarographic oxygen electrodes or Seahorse XF Analyzer platforms

    • Comparison of basal respiration rates between wild-type and mutant strains

    • Evaluation of response to uncouplers like CCCP (carbonyl cyanide m-chlorophenyl hydrazone) to assess maximal respiratory capacity

    • Measurement of inhibitor effects at various concentrations to generate dose-response curves

  • Cytochrome c Reduction Assay:

    • Spectrophotometric monitoring of cytochrome c reduction at 550 nm

    • Calculation of electron transfer rates based on cytochrome c reduction kinetics

    • Comparison between wild-type and mutant proteins under standardized conditions

  • ATP Production Measurement:

    • Luminescence-based ATP quantification assays

    • Correlation of ATP depletion patterns with inhibitor exposure

    • Comparison of ATP production capacity in resistant versus susceptible strains

  • Membrane Potential Analysis:

    • Fluorescent probe-based assessment of membrane potential (e.g., DiSC3(5))

    • Measurement of proton gradient dissipation upon inhibitor addition

    • Evaluation of membrane potential maintenance capacity in mutant strains

  • Gene Expression Profiling:

    • qRT-PCR analysis of genes involved in alternate respiratory pathways (e.g., cytochrome bd oxidase)

    • Comparison of expression patterns in wild-type versus resistant strains

    • Assessment of compensatory mechanisms in response to respiratory chain inhibition

Assay TypeKey ParametersEquipment RequiredAdvantagesLimitations
OCR MeasurementBasal rate, max capacity, spare capacitySeahorse XF Analyzer or Clark electrodeReal-time, comprehensive assessmentExpensive equipment, complex data analysis
Cytochrome c ReductionReduction rate, Km, VmaxSpectrophotometerDirect measurement of electron transferIn vitro approach may not reflect in vivo complexity
ATP ProductionATP concentration, production rateLuminometerDirectly measures bioenergetic outcomeInfluenced by multiple cellular processes
Membrane PotentialΔψ magnitude, stabilityFluorescence plate readerReflects proton-motive forceProbe interactions may affect measurements
Gene ExpressionFold-change in target genesqPCR systemReveals compensatory mechanismsReflects adaptation rather than direct function

How do mutations in the QcrA subunit specifically affect the binding of different inhibitors at the Qp site?

Mutations in the QcrA subunit can significantly alter inhibitor binding through several structural mechanisms. The Leu356Val mutation in QcrA has been shown to confer resistance to multiple QcrB inhibitors, including quinazoline derivatives, Q203, and AX-35 . This mutation is located at the quinol oxidation (Qp) site formed at the interface between QcrA and QcrB subunits.

Structural analysis based on modeling from Mycobacterium smegmatis (PDB code 6HW6) reveals that this mutation affects the stigmatellin pocket, a region previously identified as the binding site for various respiratory inhibitors . The specific mechanisms by which QcrA mutations affect inhibitor binding include:

  • Altered Pocket Geometry: The Leu356Val mutation likely changes the spatial arrangement of the Qp site, reducing the binding affinity for inhibitors while maintaining sufficient functionality for native substrates.

  • Intramolecular Communication: The mutation appears to influence binding sites that may physically interact more directly with QcrB, demonstrating the complex allosteric nature of inhibitor interactions with the cytochrome bc complex.

  • Differential Effects on Inhibitor Classes: Interestingly, the differential resistance patterns observed with various QcrA and QcrB mutations (particularly with lansoprazole sulfide) suggest that subtle differences in binding modes exist between inhibitor classes .

  • Conformational Dynamics: The mutations likely alter the dynamic properties of the Qp site, affecting the induced-fit mechanisms necessary for optimal inhibitor binding.

These findings suggest that comprehensive understanding of both QcrA and QcrB structural elements is essential for rational design of respiratory inhibitors less prone to resistance development.

What compensatory mechanisms are activated in bacteria with QcrA mutations affecting the cytochrome bc complex?

Bacteria with mutations in QcrA that affect cytochrome bc complex function activate several compensatory mechanisms to maintain energy homeostasis, as evidenced by experimental findings:

  • Cytochrome bd Oxidase Upregulation:

    • QcrA-mutant strains (QuinR-M1 with Leu356Val mutation) show significant upregulation of the cydB gene, which encodes a component of the alternative cytochrome bd oxidase

    • Expression analysis revealed 2.61±0.552 fold increase in cydB expression in the QuinR-M1 strain compared to wild-type controls, even in the absence of inhibitors

    • This alternative terminal oxidase provides a bypass mechanism for electron flow when the cytochrome bc complex is compromised

  • Metabolic Adaptations:

    • Bacterial strains with QcrA mutations likely undergo metabolic reprogramming to optimize ATP production through alternative pathways

    • This may include increased substrate-level phosphorylation to compensate for reduced oxidative phosphorylation

  • Membrane Potential Maintenance:

    • Experimental evidence suggests that strains with mutations affecting the respiratory chain develop mechanisms to maintain membrane potential even under challenging conditions

    • For instance, QcrB mutant strains showed altered responses to the uncoupler CCCP, suggesting adaptations in membrane potential regulation

  • Stress Response Activation:

    • Bacteria with compromised respiratory function typically activate stress response pathways

    • This includes potential upregulation of antioxidant systems to manage increased oxidative stress resulting from inefficient electron transport

The most significant and experimentally validated compensatory mechanism is the upregulation of the cytochrome bd oxidase, which provides an alternative terminal electron acceptor that bypasses the need for the affected cytochrome bc complex . This adaptation represents a sophisticated bacterial strategy to maintain viability despite functional impairment of a major respiratory complex.

How can structural knowledge of QcrA be leveraged for rational design of novel antimicrobial compounds?

The structural understanding of QcrA offers several strategic approaches for rational antimicrobial development:

  • Interface-Targeting Strategy:

    • Design compounds that simultaneously engage both QcrA and QcrB at their interface

    • Target the Qp site specifically, which is formed by contributions from both subunits

    • This dual-subunit targeting approach may raise the genetic barrier to resistance, as mutations would need to occur in both proteins simultaneously without compromising function

  • Resistance-Informed Design:

    • Incorporate knowledge of known resistance mutations (e.g., Leu356Val in QcrA, Trp312Gly and Gly175Ser in QcrB) into structure-based drug design

    • Develop compounds that maintain critical interactions even when common resistance mutations occur

    • Focus on structural elements that cannot be easily altered without severely compromising bacterial viability

  • Allosteric Inhibition Approaches:

    • Identify allosteric sites on QcrA that, when occupied, induce conformational changes affecting the catalytic function

    • Such sites might be less prone to resistance-conferring mutations due to their structural importance

  • Cross-Species Conservation Analysis:

    • Identify highly conserved regions within QcrA across pathogenic species

    • Target these conserved regions to develop broad-spectrum antimicrobials with reduced resistance potential

    • Use comparative structural analysis of QcrA from multiple species to identify universally critical features

  • Dynamic Structure Considerations:

    • Incorporate molecular dynamics simulations to understand QcrA's conformational flexibility

    • Design inhibitors that can accommodate or exploit these dynamic properties

    • Target transition states or intermediates that occur during the catalytic cycle

Leveraging these structural insights could lead to next-generation respiratory inhibitors with improved efficacy and reduced resistance potential. Particularly promising is the exploitation of the Qp site's dual-subunit nature, which presents unique opportunities for antimicrobial development targeting respiratory chain components.

What are the implications of QcrA mutations for clinical antimicrobial resistance and treatment strategies?

The discovery of QcrA mutations conferring resistance to respiratory inhibitors has significant clinical implications:

  • Novel Resistance Mechanism Surveillance:

    • Clinical monitoring should now include screening for QcrA mutations in addition to the previously recognized QcrB mutations

    • This expanded surveillance is crucial as respiratory chain inhibitors like Q203 advance in clinical development

    • Resistance surveillance protocols should be updated to include regions associated with both QcrA and QcrB mutations

  • Combinatorial Treatment Approaches:

    • The cross-resistance patterns observed with QcrA mutations suggest potential benefits of combination therapies

    • Specifically targeting multiple components of the respiratory chain simultaneously could reduce resistance emergence

    • For example, combining Qcr complex inhibitors with compounds targeting alternative respiratory pathways (e.g., cytochrome bd oxidase inhibitors) might be effective against strains with QcrA mutations

  • Personalized Medicine Applications:

    • Genetic screening for QcrA variants could inform treatment selection in infections like tuberculosis

    • Patients harboring strains with QcrA mutations might require alternative treatment regimens

    • This personalized approach could optimize treatment outcomes and minimize resistance amplification

  • Drug Development Prioritization:

    • The discovery of resistance via QcrA mutations should inform prioritization of respiratory chain inhibitor development programs

    • Compounds less affected by known QcrA/QcrB mutations should receive development priority

    • Notably, some compounds (like lansoprazole sulfide) maintain activity against certain mutants, suggesting potential for developing inhibitors that overcome specific resistance mechanisms

  • Resistance Prediction Modeling:

    • Structural data on resistance mutations can inform computational models to predict potential resistance pathways

    • These models could help prioritize compounds with higher genetic barriers to resistance during development

The emergence of QcrA-mediated resistance highlights the need for multifaceted approaches to antimicrobial development and treatment strategies that anticipate and counter evolutionary adaptations in bacterial respiratory systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.