Recombinant Umbelopsis ramanniana Diacylglycerol O-acyltransferase 2A (DGAT2A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. To ensure a specific tag, please specify this requirement during your order placement, and we will prioritize your request.

Synonyms
DGAT2A; Diacylglycerol O-acyltransferase 2A; Diglyceride acyltransferase 2A; MrDGAT2A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Umbelopsis ramanniana (Oleaginous fungus) (Mortierella ramanniana)
Target Names
DGAT2A
Target Protein Sequence
MASKDQHLQQKVKHTLEAIPSPRYAPLRVPLRRRLQTLAVLLWCSMMSICMFIFFFLCSI PVLLWFPIILYLTWILVWDKAPENGGRPIRWLRNAAWWKLFAGYFPAHVIKEADLDPSKN YIFGYHPHGIISMGSFCTFSTNATGFDDLFPGIRPSLLTLTSNFNIPLYRDYLMACGLCS VSKTSCQNILTKGGPGRSIAIVVGGASESLNARPGVMDLVLKRRFGFIKIAVQTGASLVP TISFGENELYEQIESNENSKLHRWQKKIQHALGFTMPLFHGRGVFNYDFGLLPHRHPIYT IVGKPIPVPSIKYGQTKDEIIRELHDSYMHAVQDLYDRYKDIYAKDRVKELEFVE
Uniprot No.

Target Background

Function

This enzyme catalyzes the terminal and rate-limiting step in triacylglycerol biosynthesis, utilizing diacylglycerol and fatty acyl-CoA as substrates. It is essential for storage lipid synthesis.

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Umbelopsis ramanniana DGAT2A and how does it function in lipid metabolism?

Umbelopsis ramanniana DGAT2A is a fungal enzyme belonging to the DGAT2 family that catalyzes the final and committed step in triacylglycerol (TG) biosynthesis. It transfers an acyl group from fatty acyl-CoA to diacylglycerol (DAG) to form triacylglycerol. This enzyme plays a critical role in lipid storage and energy metabolism. DGAT2A functions as part of the Kennedy pathway for de novo lipid synthesis, working within membrane structures to facilitate the accumulation of storage lipids. Unlike its counterpart DGAT1, which is predominantly expressed in intestinal tissues, DGAT2 is more prominently expressed in liver and adipose tissue where it contributes substantially to TG synthesis . Functional studies have demonstrated that DGAT2A is capable of forming both homodimers and larger protein complexes of approximately 650 kDa, suggesting cooperative activity in lipid synthesis pathways .

How does DGAT2A differ structurally and functionally from DGAT1?

DGAT2A and DGAT1 represent two distinct gene families that evolved separately despite catalyzing the same reaction. Structurally, DGAT2A is a smaller protein with different membrane topology compared to DGAT1. DGAT2A contains two transmembrane domains with both N and C termini oriented toward the cytosol, while having distinct catalytic roles .

What are the conserved motifs and domains in Umbelopsis ramanniana DGAT2A critical for its enzymatic activity?

Several highly conserved motifs in Umbelopsis ramanniana DGAT2A are essential for its enzymatic function:

  • The YFP (Tyrosine-Phenylalanine-Proline) motif, typically located in a luminal loop following the first transmembrane domain, plays a crucial role in substrate binding and catalysis .

  • The HPHG (Histidine-Proline-Histidine-Glycine) motif, containing the conserved His195 residue, is likely embedded in the membrane and constitutes part of the active site .

  • The transmembrane domains not only determine cellular localization but also influence substrate access and product channeling. The first transmembrane domain (TMD1) contains signals important for endoplasmic reticulum targeting .

  • Specific hydrophilic segments exclusive to fungal DGAT2s reside in the endoplasmic reticulum luminal regions and contribute to optimal enzymatic activity .

Mutation studies have demonstrated that alterations to these conserved regions significantly impair the enzyme's ability to synthesize triacylglycerols, highlighting their importance in the catalytic mechanism.

What are the optimal conditions for expressing recombinant Umbelopsis ramanniana DGAT2A in heterologous systems?

Optimal expression of recombinant Umbelopsis ramanniana DGAT2A in heterologous systems requires careful consideration of several factors:

Expression Systems:

  • Plant Expression: For expressing DGAT2A in plants like soybean, codon optimization is essential. Studies show that optimized DGAT2A genes achieve up to 20-fold increase in activity compared to only 10-fold increase with native sequences .

  • Mammalian Cell Culture: For HEK-293T, COS-7, or McArdle RH7777 cells, transfection with polyethylenimine (0.1%, pH 7.0) mixed with plasmid DNA (20 μg) in 0.15 M NaCl solution provides effective transient expression .

  • Yeast Expression: Saccharomyces cerevisiae offers a suitable expression system, particularly when using inducible promoters to control expression levels .

Promoter Selection:
For tissue-specific expression in plants, the seed-specific promoter 7S-α prime has proven effective in driving high-level expression during seed development .

Expression Conditions:

  • Temperature: Standard cell culture conditions (37°C for mammalian cells, 30°C for yeast)

  • Duration: Peak protein expression typically occurs 24-48 hours post-transfection in mammalian systems

  • Media supplements: Addition of fatty acids can stimulate DGAT2A translocation to lipid droplets, enhancing activity measurement

Purification Considerations:
As an integral membrane protein, DGAT2A requires detergent-based extraction methods, with care taken to maintain the native conformation and activity of the enzyme.

How can researchers effectively analyze DGAT2A protein-protein interactions?

Several complementary techniques are recommended for investigating DGAT2A protein-protein interactions:

Chemical Cross-linking:

  • Resuspend total cellular membranes (1 μg/μl protein) in 10 mM Hepes (pH 7.4)/1 mM EDTA

  • Incubate with disuccinimidyl suberate (DSS) at varied concentrations (dissolved in DMSO, 2.5% final)

  • Allow reactions to proceed for 30 minutes at room temperature

  • Terminate by adding 1/10 volume of 1 M Tris-Cl (pH 8.0)

  • Analyze by SDS-PAGE and immunoblotting

This approach has successfully demonstrated DGAT2 self-association into dimers and higher-order complexes.

Co-immunoprecipitation:
Using differentially tagged proteins (e.g., FLAG-DGAT2A and another protein of interest with HA tag), researchers can identify interacting partners. This method has revealed that DGAT2 interacts with monoacylglycerol acyltransferase (MGAT2), suggesting functional coupling for efficient triacylglycerol synthesis .

In Situ Proximity Ligation Assay:
This technique detects protein interactions in their native cellular context with high specificity. It has successfully demonstrated the DGAT2-MGAT2 interaction in intact cells .

Deletion Mutagenesis:
Creating truncated versions of DGAT2A has helped identify domains essential for protein interactions. For example, studies show that DGAT2's interaction with MGAT2 depends on its two transmembrane domains .

By combining these approaches, researchers can construct a comprehensive picture of DGAT2A's interaction network and better understand how these interactions influence its enzymatic function.

What is the subcellular localization pattern of DGAT2A and how does it change during active lipid synthesis?

Umbelopsis ramanniana DGAT2A exhibits dynamic subcellular localization that changes in response to metabolic conditions:

Basal Conditions:
Under standard conditions, DGAT2A primarily localizes to the endoplasmic reticulum (ER) membrane where it participates in the normal biosynthetic pathway for triacylglycerol formation. Both the N and C termini are oriented toward the cytosol, with transmembrane domains anchoring the protein in the ER membrane .

During Active Lipid Synthesis:
When cells are exposed to increased fatty acid levels, DGAT2A redistributes to include both ER and lipid droplet localization. This translocation appears to be a regulated process that enhances TG synthesis at the site of lipid storage:

  • Studies show that incubating McArdle rat hepatoma RH7777 cells with 2-monoacylglycerol triggers DGAT2 translocation to lipid droplets

  • This translocation coincides with the formation of large cytosolic lipid droplets

  • The process appears to be specific to DGAT2, as DGAT1 does not show the same behavior

Role of Transmembrane Domains:
The transmembrane domains play a crucial role in proper localization. Deletion studies have shown that:

  • The first transmembrane domain (TMD1) contains signals necessary for ER targeting

  • A DGAT2 mutant lacking both transmembrane domains localizes primarily to mitochondria rather than the ER

  • Surprisingly, this mutant remains enzymatically active and can still interact with lipid droplets

This dynamic localization pattern suggests that DGAT2A can function as part of a mobile enzyme system that responds to cellular lipid status by repositioning to sites where its activity is most needed.

How does the expression pattern of DGAT2A change during seed development?

The expression pattern of DGAT2A during seed development follows a precise temporal program, with distinct profiles for mRNA, protein levels, and enzymatic activity:

mRNA Expression Pattern:

  • Increases during early seed development (stages 1-4)

  • Peaks before seed expansion is complete

  • Declines significantly as seeds begin to turn yellow and desiccate (stages 8-9)

Protein and Activity Profile:

  • Increases early in development

  • Reaches peak levels by mid-development

  • Maintains high levels throughout seed desiccation and in mature seeds

This pattern differs notably from endogenous DGAT activity in soybean and other oilseeds (like Brassica napus and Carthamus tinctorius), which typically peak early in development and decrease as seeds mature.

Developmental Expression Data:

Developmental StageUrDGAT2A mRNA LevelUrDGAT2A Protein LevelDGAT ActivitySeed Characteristics
Early (stages 1-3)IncreasingIncreasingLow to mediumGreen, small, developing
Mid (stages 4-6)Peak, then decliningHighHighGreen, expanding
Late (stage 7)LowHighHighGreen to yellow transition
Mature (stages 8-9)Very lowHighHighYellow, desiccating

This unique expression pattern in transgenic seeds—where protein levels and activity remain high even as mRNA decreases—suggests post-transcriptional regulatory mechanisms and contributes to the increased oil content observed in mature transgenic seeds .

What membrane topology models have been proposed for DGAT2 enzymes, and how do they differ between species?

Different topology models have been proposed for DGAT2 enzymes across species, revealing both conserved features and significant variations:

Mammalian DGAT2 Topology:

  • Contains two transmembrane domains

  • Both N and C termini face the cytosol

  • A short luminal loop connects the transmembrane domains

  • Most of the protein (including the active site) faces the cytosol

  • Forms homodimers and larger protein complexes of ~650 kDa

Yeast (Saccharomyces cerevisiae) DGAT2 Topology:

  • Similar basic organization with both N and C termini in the cytosol

  • Contains a long endoplasmic reticulum luminal loop following the first transmembrane domain

  • The conserved YFP motif (residues 129-131) resides in this luminal loop

  • The HPHG motif with the critical His195 is likely embedded in the membrane

Key Differences Between Species:

  • The location of functional motifs differs significantly between yeast and mammalian DGAT2

  • Yeast DGAT2 contains a hydrophilic segment in the luminal loop that is absent in mammalian DGAT2

  • The relative size of the luminal loop varies considerably between species

These topological differences may reflect adaptations to specific cellular environments or substrate preferences. Researchers should be aware that findings about membrane topology from one species may not directly translate to DGAT2 enzymes from other organisms, including Umbelopsis ramanniana DGAT2A .

How does expression of recombinant Umbelopsis ramanniana DGAT2A affect oil content in transgenic plants?

Expression of recombinant Umbelopsis ramanniana DGAT2A in transgenic plants has demonstrated significant effects on oil content and composition:

Quantitative Effects on Oil Content:

  • In transgenic soybean, expression of codon-optimized UrDGAT2A resulted in a 1-2% absolute increase in seed oil content

  • This effect occurred without significant changes in protein content, addressing a major concern in oilseed engineering

  • Gene dosage showed a positive correlation with phenotype, with homozygous seeds showing higher oil content than hemizygous or null seeds

Comparative Performance:

  • Codon-optimized UrDGAT2A (up to 20-fold increase in DGAT activity) outperformed native UrDGAT2A (up to 10-fold increase)

  • These results are comparable to studies in other plants:

    • Arabidopsis: 9-12% absolute increase when overexpressing endogenous DGAT1

    • Maize: Approximately 1% increase when overexpressing endogenous DGAT1

Oil Content Comparison in Transgenic Plants:

Plant SpeciesDGAT Expression SystemOil Content IncreaseDGAT Activity IncreaseReference
SoybeanCodon-optimized UrDGAT2A1-2% absoluteUp to 20-fold
SoybeanNative UrDGAT2A<1% absoluteUp to 10-fold
ArabidopsisEndogenous DGAT1 overexpression9-12% absoluteNot reported
MaizeEndogenous DGAT1 overexpression~1% absoluteNot reported

These findings demonstrate that recombinant UrDGAT2A expression represents a viable strategy for increasing oil content in crop plants with potential commercial applications .

What is the impact of DGAT2A overexpression on lipid droplet formation and morphology?

DGAT2A overexpression has distinctive effects on both the formation and morphology of cellular lipid droplets:

Lipid Droplet Formation Dynamics:

  • DGAT2A overexpression significantly accelerates and enhances lipid droplet formation

  • When co-expressed with MGAT2 (monoacylglycerol acyltransferase-2), an even greater increase in triacylglycerol storage is observed compared to expression of either enzyme alone

Morphological Changes:

  • DGAT2A overexpression characteristically leads to the formation of large cytosolic lipid droplets

  • This phenotype is distinct from DGAT1 overexpression, which typically results in smaller, more numerous lipid droplets

  • When McArdle RH7777 cells are incubated with 2-monoacylglycerol, DGAT2A translocation to lipid droplets occurs, accompanied by the formation of these characteristic large droplets

Substrate Influence:

  • The presence of specific lipid substrates affects both DGAT2A localization and the resulting lipid droplet morphology

  • DGAT2A can effectively utilize monoacylglycerol-derived diacylglycerol for TG synthesis, influencing droplet formation patterns

Mechanism of Action:
The ability of DGAT2A to generate larger lipid droplets likely stems from:

  • Its capacity to form protein complexes that enhance localized TG synthesis

  • Its dynamic translocation between the ER and lipid droplets during active synthesis

  • Its interaction with other lipid biosynthetic enzymes like MGAT2, creating an efficient substrate channeling system

These findings have important implications for understanding cellular lipid trafficking and storage mechanisms, as well as potential applications in metabolic engineering.

What is the potential of DGAT2A as a therapeutic target for metabolic diseases like NASH?

DGAT2A has emerged as a potential therapeutic target for metabolic diseases, particularly nonalcoholic steatohepatitis (NASH), with research revealing both promising aspects and important considerations:

Rationale for Targeting DGAT2:

  • DGAT2 is prominently expressed in liver and adipose tissue, making it an accessible target for addressing lipid accumulation in these tissues

  • NASH is characterized by triglyceride accumulation, severe inflammation, and fibrosis, with fat accumulation hypothesized as the primary driver

  • As a key enzyme in triglyceride synthesis, DGAT2 inhibition could potentially reduce hepatic steatosis

Preclinical Evidence:

Clinical Evidence:

  • Initial human trials using pharmacological agents or ASOs targeting DGAT2 have shown:

    • Diminished liver triglycerides

    • Indications of lower liver damage

    • Suggestions of reduced fibrosis

Therapeutic Considerations:

AspectPotential BenefitPotential ConcernResearch Status
Hepatic SteatosisDemonstrated reduction in animal models and early human trials-Well-established
InflammationPossible reductionSome studies show increased inflammationContradictory findings
FibrosisEarly human trials suggest improvementAnimal studies show mixed resultsNeeds further research
Target SpecificityDGAT2 vs. DGAT1 targeting may reduce intestinal side effectsPotential compensatory mechanismsActive area of investigation

Future Directions:
While preliminary evidence suggests potential benefits of DGAT2 inhibition for NASH, the degree to which targeting DGAT2 alone will yield effective therapy for the severe inflammation and fibrosis components of NASH remains unclear . Further research is needed to:

  • Clarify the mechanisms by which DGAT2 inhibition affects inflammatory pathways

  • Determine optimal dosing to balance lipid reduction with potential side effects

  • Explore combination therapies targeting multiple aspects of NASH pathogenesis

What are the critical amino acid residues for DGAT2A catalytic activity, and how do mutations affect enzyme function?

Research has identified several critical amino acid residues and motifs essential for DGAT2A catalytic activity, with mutations producing varied effects on enzyme function:

Key Catalytic Residues:

  • YFP Motif (residues 129-131 in yeast):

    • Highly conserved across species

    • Located in the ER luminal loop following the first transmembrane domain in yeast

    • Essential for enzyme catalysis

  • HPHG Motif:

    • The histidine residue (His195 in yeast) within this motif is likely part of the active site

    • Probably embedded in the membrane

    • Histidine may function as a base in the catalytic mechanism

  • Transmembrane Domains:

    • While not directly involved in catalysis, they are crucial for proper enzyme localization and substrate access

    • Also mediate protein-protein interactions that affect activity

Mutation Effects Table:

Mutation TypeEffect on ActivityEffect on LocalizationMechanistic Implication
YFP motif mutationsSevere loss of activityMinimal effect on localizationDirect involvement in catalysis or substrate binding
HPHG motif mutationsSignificant reduction in activityMinimal effect on localizationActive site disruption
Transmembrane domain deletionsVariable (can retain activity)Redistribution from ER to mitochondriaComplex role in activity regulation
C-terminal mutationsModerate to severe activity lossMinimal effect on localizationInvolvement in substrate binding or product release
N-terminal mutationsLess severe activity reductionPotential alteration of membrane associationRegulatory rather than direct catalytic role

Structure-Function Relationships:

  • Studies suggest that DGAT2 functions in a multimeric complex consisting of several DGAT2 subunits

  • This oligomerization likely influences substrate access and product channeling

  • The precise arrangement of the active site remains under investigation, but evidence suggests involvement of both membrane-embedded and cytosolic-facing residues

These findings provide crucial insights for protein engineering efforts aimed at enhancing DGAT2A activity or altering its substrate specificity for biotechnological applications.

How do species-specific variations in DGAT2A sequence and structure influence substrate specificity and activity?

Species-specific variations in DGAT2A sequence and structure significantly influence its substrate specificity and enzymatic activity, reflecting evolutionary adaptations to different lipid metabolic requirements:

Taxonomic Variations:

Structural Determinants of Substrate Specificity:

The substrate preferences across species appear to be determined by several structural features:

  • Transmembrane Domain Architecture:

    • Variations in the number, length, and positioning of transmembrane domains affect membrane positioning and substrate access

    • These differences influence which pool of diacylglycerol substrates the enzyme can access

  • Luminal Loop Regions:

    • The significant variation in luminal loop size and composition between species correlates with different substrate preferences

    • In yeast, the extended luminal loop contains elements essential for catalysis

  • C-terminal Domain:

    • Differences in the C-terminal region affect substrate recognition

    • May influence the enzyme's preference for saturated versus unsaturated fatty acyl-CoAs

Functional Consequences of Variation:

Species SourcePreferred DAG SubstratesPreferred Acyl-CoA SubstratesNotable Enzymatic Properties
Umbelopsis ramannianaBroad rangeBroad rangeHigh specific activity, functions well in heterologous systems
Plant (e.g., Ricinus communis)sn-1,2-DAGMay prefer unusual FAsOften specialized for specific fatty acid incorporation
Mammalssn-1,2-DAGOleoyl-CoA, palmitoyl-CoAForms functional complexes with related enzymes

These species differences have important implications for biotechnological applications. The ability of fungal DGAT2A to function efficiently when expressed in plants, as demonstrated with Umbelopsis ramanniana DGAT2A in soybean, highlights its potential versatility as a biotechnological tool for modifying oil content in diverse organisms .

What are the most significant recent advances in DGAT2A research and what questions remain unresolved?

Significant recent advances in DGAT2A research have expanded our understanding of this enzyme's structure, function, and biotechnological potential, while several important questions remain to be addressed.

Recent Advances:

  • Structural Insights:

    • Elucidation of membrane topology models for DGAT2 from different species

    • Identification of critical functional motifs and their spatial organization

    • Discovery that DGAT2 forms dimers and exists in larger protein complexes

  • Protein-Protein Interactions:

    • Demonstration of functional interaction between DGAT2 and MGAT2

    • Evidence for substrate channeling in TG synthesis

    • Characterization of DGAT2's dynamic translocation between ER and lipid droplets

  • Biotechnological Applications:

    • Successful expression of fungal DGAT2A in plants with measurable increases in oil content

    • Development of codon-optimization strategies to enhance heterologous expression

    • Correlation between DGAT2A gene dosage and phenotypic effects in transgenic plants

  • Therapeutic Potential:

    • Early clinical trials exploring DGAT2 inhibition for NASH treatment

    • Improved understanding of DGAT2's role in hepatic steatosis and potential impact on inflammation and fibrosis

Unresolved Questions:

  • Structural Details:

    • High-resolution crystal structure of DGAT2A remains unavailable

    • Precise arrangement of the active site and substrate-binding pocket is unknown

    • Molecular basis for substrate specificity differences between species is incompletely understood

  • Regulatory Mechanisms:

    • How is DGAT2A activity post-translationally regulated?

    • What signals trigger DGAT2A translocation between cellular compartments?

    • How do cells coordinate DGAT1 and DGAT2 activity under different metabolic conditions?

  • Therapeutic Applications:

    • Will DGAT2 inhibition effectively address both steatosis and inflammatory aspects of NASH?

    • How can potential compensatory mechanisms be managed in therapeutic approaches?

    • What is the optimal degree of DGAT2 inhibition for therapeutic benefit without adverse effects?

  • Biotechnological Optimization:

    • How can DGAT2A be further engineered to increase oil yield in crops?

    • What are the limits of oil content increase achievable through DGAT2A manipulation?

    • Can DGAT2A be modified to alter fatty acid composition of storage oils?

Addressing these unresolved questions will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and metabolic engineering.

What are the most promising future directions for DGAT2A research in agricultural biotechnology and human health?

Future research on DGAT2A holds significant promise for both agricultural biotechnology and human health applications, with several directions showing particular potential:

Agricultural Biotechnology:

  • Enhanced Crop Oil Production:

    • Development of second-generation DGAT2A variants with improved catalytic efficiency

    • Creation of tissue-specific expression systems to maximize oil accumulation without affecting plant development

    • Exploration of DGAT2A genes from diverse species to identify those with optimal performance in crop plants

  • Designer Oils with Modified Fatty Acid Composition:

    • Engineering DGAT2A substrate specificity to incorporate beneficial fatty acids (omega-3, medium-chain, etc.)

    • Combining DGAT2A overexpression with fatty acid biosynthesis modifications

    • Developing DGAT2A variants that can utilize unusual acyl-CoAs more efficiently

  • Stress-Responsive Oil Production:

    • Creating regulatory systems that activate DGAT2A expression under specific environmental conditions

    • Developing crops with enhanced energy storage capacity for stress tolerance

    • Exploring the potential of DGAT2A manipulation to improve post-harvest seed stability

Human Health Applications:

  • Therapeutic Development for Metabolic Disorders:

    • Refinement of DGAT2 inhibitors with improved specificity and reduced side effects

    • Tissue-specific DGAT2 modulation to target hepatic steatosis while preserving essential functions

    • Combination therapies addressing multiple aspects of NASH pathogenesis

  • Biomarkers and Personalized Medicine:

    • Investigation of DGAT2 genetic variants as predictors of metabolic disease risk

    • Development of assays to measure DGAT2 activity as a biomarker for disease progression

    • Identification of patient subgroups most likely to benefit from DGAT2-targeted therapies

  • Cell-Based Models and Screening Platforms:

    • Creation of improved cellular systems expressing recombinant DGAT2A for drug screening

    • Development of high-throughput assays to identify novel DGAT2 modulators

    • Engineering of reporter systems to visualize DGAT2 activity in real-time

Integrative Research Opportunities:

  • Structural Biology Breakthroughs:

    • Determination of high-resolution DGAT2A crystal structure

    • Computational modeling of substrate binding and catalytic mechanism

    • Structure-guided design of improved DGAT2A variants for various applications

  • Systems Biology Approaches:

    • Integration of DGAT2A into comprehensive models of lipid metabolism

    • Multi-omics studies to understand global effects of DGAT2A modulation

    • Network analysis to identify optimal intervention points in lipid metabolic pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.