Recombinant Uncharacterized 34.8 kDa protein in hlyA 3'region

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Uncharacterized 34.8 kDa protein in hlyA 3'region
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Edwardsiella tarda
Target Protein Sequence
MNAYSYMLIKNPDVNFEGITINGYVDLPGRIVQDQKNARSHAVTWDTKVKKQLLDTLNGI VEYDTTFDNYYETMVEAINTGDGETLKEGITDLRGEIQQNQKYAQQLIEELTKLRDSIGH DVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNVMKGAILGLPI IGGIIVGVARDNLGKLEPLLAELRQTVDYKVTLNRVVGVAYSNINEIDKALDDAINALTY MSTQWHDLDSQYSGVLGHIENAAQKADQNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIK ELKVETVTPQK
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the uncharacterized 34.8 kDa protein in hlyA 3'region and what are its basic properties?

The uncharacterized 34.8 kDa protein in hlyA 3'region is a protein from Edwardsiella tarda with 311 amino acids. Based on available data, it appears to be located in proximity to the hlyA gene, which typically encodes hemolysin A, a pore-forming toxin that contributes to bacterial virulence. The commercially available recombinant form is expressed in E. coli with a His-tag for purification purposes .

The basic properties of this protein include:

PropertyInformation
Source organismEdwardsiella tarda
Molecular weight34.8 kDa
Amino acid length311 amino acids (full length)
Expression systemE. coli
Available tagsHis-tag
Gene regionhlyA 3'region

For researchers beginning work with this protein, initial characterization should include verification of size by SDS-PAGE, confirmation of identity through mass spectrometry, and assessment of purity through chromatographic methods.

What expression systems and conditions are optimal for producing soluble recombinant 34.8 kDa protein?

The recombinant production of uncharacterized proteins requires systematic optimization. E. coli has been successfully used for expressing this protein , but researchers should consider multiple expression systems and conditions to maximize yield and solubility.

When working with E. coli expression systems, several methodologies can improve production:

  • Optimization of expression temperature: Lower temperatures (16-20°C) often minimize inclusion body formation and improve protein solubility by slowing down translation and allowing proper folding .

  • Media formulation: Complex vs. defined media affects production differently. In defined glucose-supplemented mineral salt medium, recombinant protein expression can create greater metabolic burden than in rich media like LB .

  • Induction strategy: Consider the following experimental design:

ParameterVariations to test
Inducer concentration0.1 mM, 0.5 mM, 1.0 mM IPTG
Induction OD6000.5, 0.8, 1.2
Induction temperature16°C, 25°C, 37°C
Induction duration4h, 8h, overnight
  • Vector design: For difficult-to-fold proteins, consider using solubility-enhancing fusion tags (MBP, SUMO, TrxA) in addition to the His-tag .

Design of Experiments (DoE) methodology is strongly recommended for efficiently optimizing these conditions, as it allows assessment of factor interactions that the inefficient one-factor-at-a-time approach cannot capture .

How can researchers design experiments to determine if the uncharacterized 34.8 kDa protein interacts with β2 integrins?

Given HlyA's demonstrated interaction with β2 integrins in cytotoxicity studies , investigating whether the uncharacterized 34.8 kDa protein shares similar interactions is scientifically relevant. A methodological approach should include:

  • Far-Western blotting: This technique effectively detected direct interactions between HlyA and β2 integrin subunits in previous studies . Researchers should immobilize purified recombinant β2 integrin family members (αLβ2, αMβ2, αXβ2, αDβ2) on membranes and probe with the purified 34.8 kDa protein followed by specific antibody detection.

  • Co-immunoprecipitation assays: Express the 34.8 kDa protein in appropriate cells expressing β2 integrins, then perform immunoprecipitation with anti-His tag antibodies (or antibodies against the protein if available) and analyze precipitates for the presence of β2 integrin subunits.

  • Surface plasmon resonance (SPR): Quantitatively measure binding kinetics between the 34.8 kDa protein and purified β2 integrin subunits or heterodimers.

  • Cellular binding assays: Test binding of the labeled recombinant protein to cells expressing different β2 integrin combinations, similar to experiments with HlyA .

  • Competitive binding assays: Determine if the 34.8 kDa protein competes with HlyA for binding to β2 integrins, which would suggest shared binding sites.

These methodologies will help determine whether the 34.8 kDa protein, like HlyA, interacts with the β2 integrin β subunit specifically or with particular αβ heterodimers.

What experimental approaches should be used to characterize the functional role of this uncharacterized protein?

Characterizing an uncharacterized protein requires a multi-faceted approach combining computational predictions with experimental validation:

  • Gene knockout and complementation: Generate deletion mutants of the gene encoding the 34.8 kDa protein in Edwardsiella tarda and assess phenotypic changes, particularly in relation to hemolytic activity and virulence. Complementation with the wild-type gene should restore the original phenotype.

  • Protein-protein interaction screening:

    • Bacterial two-hybrid system

    • Pull-down assays using His-tagged protein

    • Cross-linking coupled with mass spectrometry

    • Co-immunoprecipitation from bacterial lysates

  • Subcellular localization: Determine whether the protein is cytoplasmic, membrane-associated, or secreted using cell fractionation techniques and immunoblotting.

  • Functional assays based on HlyA properties: Given its genomic proximity to hlyA, test whether the 34.8 kDa protein influences:

    • Hemolytic activity using red blood cell lysis assays

    • Pore formation using artificial membrane systems

    • Cytotoxicity in various cell lines, particularly those expressing β2 integrins

  • Structural analysis: Conduct circular dichroism spectroscopy for secondary structure determination, and if possible, X-ray crystallography or NMR for high-resolution structural information.

How does recombinant production of the 34.8 kDa protein impact host cell metabolism, and what strategies can mitigate these effects?

Recombinant protein production often creates metabolic burden in production hosts. Research has revealed that this burden stems from multiple factors that researchers must consider when producing the 34.8 kDa protein:

  • Transcriptional burden: Studies show that transcription of recombinant genes, rather than translation itself, can significantly inhibit cell growth . For difficult-to-fold proteins, this effect is compounded by protein folding problems.

  • Expression system design: When producing the 34.8 kDa protein, consider these experimental findings:

    • Cells expressing GFP (an easy-to-fold protein) in LB medium showed that translation did not negatively affect growth, whereas cells producing difficult-to-fold proteins (like hFGF-2) showed growth inhibition even in rich media .

    • In defined glucose-supplemented mineral salt medium, even well-folded proteins caused growth inhibition, indicating media composition influences metabolic burden .

  • Mitigation strategies based on experimental evidence:

ChallengeExperimental approachRationale
Transcriptional burdenUse weaker promoters or tightly regulated expression systemsReduces unnecessary transcription
Protein folding stressCo-express molecular chaperonesAssists proper folding of difficult proteins
Energy drainImplement fed-batch cultivation with balanced nutrient feedingProvides constant energy source for growth and production
Metabolic imbalanceSupplement with precursor metabolitesSupports central carbon metabolism during production
  • Monitoring approaches: Track growth rates, oxygen consumption, metabolite production, and stress response gene expression to identify specific bottlenecks in your production system.

What contradictions exist in the current understanding of HlyA-β2 integrin interactions, and how might they inform research on the 34.8 kDa protein?

The literature reveals several contradictions regarding HlyA-β2 integrin interactions that are relevant when studying the uncharacterized 34.8 kDa protein:

  • Contradictory findings on β2 integrin requirement:

    • Lally et al. found that β2 integrin expression in K562 cells increased sensitivity to HlyA cytotoxicity .

    • Morova et al. identified glycosylation state as important for HlyA activity .

    • Valeva et al. argued that α<sub>L</sub>β<sub>2</sub> enhances sensitivity to all pore-forming toxins, suggesting non-specific effects .

    • Munksgaard et al. found no increased sensitivity in K562 cells transfected with α<sub>L</sub>β<sub>2</sub> .

  • Unexpected findings on α subunit requirements:

    • Research using CRISPR knockout methodology showed that no single α subunit was necessary for HlyA sensitivity .

    • Surprisingly, quadruple α knockout cells (Δα<sub>DLMX</sub>) retained some β<sub>2</sub> expression and HlyA sensitivity, whereas complete β<sub>2</sub> knockout cells were resistant .

    • Far-Western blotting demonstrated direct interaction between HlyA and the β<sub>2</sub> subunit, but not with any α subunits .

These contradictions highlight several methodological considerations for studying the 34.8 kDa protein:

  • Use multiple cell types and methodologies: Given the conflicting results with K562 cells, researchers should employ diverse cell lines and complementary techniques.

  • Consider β<sub>2</sub> subunit interactions independently: Since HlyA appears to interact directly with the β<sub>2</sub> subunit independent of α subunits, design experiments to test if the 34.8 kDa protein follows a similar pattern.

  • Investigate glycosylation effects: Test if host cell glycosylation status affects any interactions between the 34.8 kDa protein and cellular components.

  • Employ genetic knockout approaches carefully: The complex results from α subunit knockouts suggest that compensatory mechanisms may exist, requiring careful experimental design and controls.

How should researchers design experiments to optimize purification of the His-tagged 34.8 kDa protein?

Purification optimization for recombinant proteins requires systematic experimental design rather than the inefficient one-factor-at-a-time approach. For the His-tagged 34.8 kDa protein, implement a Design of Experiments (DoE) methodology as follows:

  • Initial screening design: Use a fractional factorial design to identify significant factors affecting purification yield and purity:

FactorLow levelHigh level
Lysis buffer pH7.08.5
Imidazole concentration in wash buffer10 mM40 mM
NaCl concentration150 mM500 mM
Flow rate0.5 mL/min2 mL/min
Incubation time with resin30 min120 min
  • Response surface methodology (RSM): Once significant factors are identified, use RSM to optimize conditions and model interaction effects for maximum yield and purity .

  • Optimization for specific challenges:

    • If the protein forms inclusion bodies: Test solubilization with different concentrations of urea or guanidine HCl (4-8M) followed by on-column refolding

    • If co-purifying contaminants are present: Test dual affinity approaches or ion exchange chromatography as a secondary step

  • Quality control metrics: Establish acceptance criteria for:

    • Purity (>95% by SDS-PAGE)

    • Endotoxin levels (<0.1 EU/μg protein)

    • Aggregation state (monodisperse by dynamic light scattering)

    • Properly folded state (circular dichroism profile)

This DoE approach enables efficient optimization of multiple variables simultaneously, reducing experimental time and resources while identifying optimal conditions that might be missed by one-factor-at-a-time approaches .

What methodological approaches can resolve protein folding challenges when expressing the 34.8 kDa protein?

Protein folding challenges are common with recombinant proteins, particularly those from different organisms. For the 34.8 kDa protein, several experimental approaches can address folding issues:

  • Expression condition screening: Research indicates that protein folding problems significantly contribute to growth inhibition during recombinant protein production . Systematic testing should include:

ParameterTest conditionsAssessment method
Temperature15°C, 25°C, 37°CSDS-PAGE of soluble vs. insoluble fractions
Induction strength0.01-1.0 mM IPTGSDS-PAGE quantification of soluble protein
Co-expression of chaperonesDnaK/DnaJ/GrpE, GroEL/GroESComparison of soluble yield with/without chaperones
Fusion partnersMBP, SUMO, TrxA, GSTSolubility and activity comparison
  • Inclusion body recovery protocol: If the protein predominantly forms inclusion bodies like hFGF-2 , establish a refolding protocol:

    • Solubilize inclusion bodies in 8M urea or 6M guanidine HCl

    • Test stepwise dialysis vs. rapid dilution refolding methods

    • Optimize redox conditions (GSH/GSSG ratios) if the protein contains disulfide bonds

    • Evaluate additives like L-arginine, glycerol, or sucrose to prevent aggregation during refolding

  • Structural analysis during optimization: Use circular dichroism spectroscopy to monitor secondary structure during refolding optimization, ensuring the protein achieves its native conformation.

  • Activity assays: Develop functional assays based on predicted activities to confirm that refolded protein retains biological activity.

This systematic approach addresses the specific challenges of protein folding, which research has shown to be a significant factor in recombinant protein production difficulties, particularly in defined media conditions .

How might the 34.8 kDa protein contribute to HlyA-mediated cytotoxicity and bacterial pathogenesis?

Understanding the potential role of the 34.8 kDa protein in HlyA-mediated cytotoxicity requires investigation of several mechanistic hypotheses:

  • Interaction with β2 integrins: Research has established that HlyA interacts directly with the β2 integrin subunit, independent of α subunits . Experimental approaches to investigate similar roles for the 34.8 kDa protein include:

    • Testing whether the 34.8 kDa protein directly binds β2 integrin subunits using far-Western blotting

    • Comparing cytotoxicity in wild-type cells versus β2 integrin knockout cells

    • Investigating competition or synergy between HlyA and the 34.8 kDa protein for β2 binding

  • Contribution to pore formation: HlyA functions as a pore-forming toxin. Methods to assess the 34.8 kDa protein's potential involvement include:

    • Liposome permeabilization assays with purified protein

    • Cell membrane integrity assays (LDH release, propidium iodide uptake)

    • Electrophysiology measurements of membrane conductance

  • Regulatory role in HlyA expression or function: Given its genomic proximity to hlyA, the 34.8 kDa protein might regulate HlyA. Investigate through:

    • qRT-PCR analysis of hlyA expression in wild-type vs. 34.8 kDa protein knockout strains

    • Hemolytic activity assays comparing wild-type and mutant bacteria

    • Protein-protein interaction studies between HlyA and the 34.8 kDa protein

  • Host response modulation: The protein might influence host immune responses. Methodologies include:

    • Cytokine profiling of host cells exposed to purified protein

    • NFκB activation assays in the presence/absence of the protein

    • Neutrophil recruitment and function studies in infection models

These experimental approaches will help determine whether the 34.8 kDa protein is a virulence factor in its own right or plays a supporting role in HlyA-mediated pathogenesis.

What bioinformatic approaches can predict the function of this uncharacterized protein and guide experimental design?

Computational analysis can provide crucial insights that direct experimental efforts more efficiently:

  • Sequence-based analysis:

    • PSI-BLAST searches against non-redundant protein databases to identify distant homologs

    • Motif scanning using PROSITE, ELM, and ScanProsite

    • Secondary structure prediction using PSIPRED, JPred

    • Disorder prediction using PONDR, IUPred

  • Structural prediction and analysis:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structure-based function prediction using ProFunc, COFACTOR

    • Ligand binding site prediction using 3DLigandSite, COACH

    • Protein-protein interaction surface prediction using PredUs, SPPIDER

  • Genomic context analysis:

    • Examine operonic structure around the gene

    • Identify conserved gene neighborhoods across related species

    • Apply phylogenetic profiling to identify co-evolving genes

  • Integration with experimental data:

    • Map potential binding sites for β2 integrins based on HlyA interaction data

    • Design targeted mutagenesis experiments based on predicted functional residues

    • Develop function-specific assays based on computational predictions

Researchers should use these computational predictions to formulate testable hypotheses rather than accepting them as definitive functional assignments, as experimental validation remains essential for uncharacterized proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.