Recombinant Uncharacterized ABC transporter ATP-binding protein Mb2353c (Mb2353c)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant Mb2353c protein is produced using E. coli expression systems, a common approach for generating recombinant mycobacterial proteins due to the ease of genetic manipulation and high yield capabilities . Following expression, the protein is purified to greater than 90% purity as determined by SDS-PAGE analysis, making it suitable for various research applications . The addition of the His-tag facilitates purification through affinity chromatography methods, allowing for efficient isolation of the protein from bacterial lysates.

The final product is typically provided as a lyophilized powder, which enhances stability during storage and transportation . This format requires reconstitution before use in experimental settings, with specific recommendations for optimal reconstitution procedures.

ABC Transporters: General Characteristics

ATP-binding cassette (ABC) transporters represent one of the largest protein superfamilies, characterized by their ability to utilize the energy from ATP hydrolysis to transport various substances across cellular membranes . These transporters play critical roles in numerous biological processes across species, from bacteria to humans. ABC transporters typically consist of transmembrane domains that form the pathway for substrate translocation and nucleotide-binding domains that bind and hydrolyze ATP .

While many ABC transporters have been well-characterized in various organisms, the functions of many remain uncharacterized, especially in bacterial species like Mycobacterium bovis. The "uncharacterized" designation for Mb2353c indicates that the specific substrates it transports and its precise physiological roles have not yet been fully determined.

Mycobacterium bovis Context

Mycobacterium bovis is a member of the Mycobacterium tuberculosis complex and is the primary causative agent of tuberculosis in cattle and other animals. It can also infect humans, causing zoonotic tuberculosis that is clinically indistinguishable from M. tuberculosis infection. Understanding the functions of proteins like Mb2353c is important for comprehending the biology and pathogenesis of this significant pathogen.

In mycobacterial species, ABC transporters have been implicated in various functions including:

  • Import of nutrients and essential compounds

  • Export of toxins and antibiotics

  • Cell wall biosynthesis and maintenance

  • Virulence and pathogenesis

The specific role of Mb2353c within M. bovis remains an active area of investigation, with researchers seeking to determine its substrates and physiological relevance.

Relationship to M. tuberculosis Homologs

Mycobacterium bovis shares high genomic similarity with Mycobacterium tuberculosis, with many genes showing identical or near-identical sequences between the two species . The comparative genomics data available for M. bovis AF2122/97 and M. tuberculosis H37Rv strains provides context for understanding the evolutionary conservation of proteins like Mb2353c.

While the search results don't specifically mention the M. tuberculosis homolog of Mb2353c, the protein likely has a counterpart in M. tuberculosis given the high genetic similarity between these species . Comparative studies of such homologs can provide insights into the functional importance and evolutionary conservation of these ATP-binding proteins across mycobacterial species.

Conservation and Variation

The study of identical and variable gene sets between M. bovis and M. tuberculosis, as mentioned in search result , suggests that proteins highly conserved between these species may play essential roles in mycobacterial biology. The degree of conservation of Mb2353c across mycobacterial species could indicate its functional importance, though specific information about this conservation is not provided in the available search results.

Potential Research Applications

The recombinant Mb2353c protein has several potential applications in mycobacterial research:

  1. Structural studies to determine three-dimensional protein architecture

  2. Functional assays to identify substrates and transport characteristics

  3. Protein-protein interaction studies to map molecular networks

  4. Development of inhibitors or modulators for potential therapeutic applications

  5. Immunological studies to assess antigenic properties

These research directions could contribute to a better understanding of M. bovis biology and potentially reveal new targets for intervention in mycobacterial infections.

Predicted Functions Based on Sequence Analysis

While the specific function of Mb2353c remains uncharacterized, its classification as an ABC transporter ATP-binding protein suggests several possible roles. The presence of characteristic ABC transporter domains, including the nucleotide-binding domain with conserved ATP-binding motifs, indicates its involvement in energy-dependent transport processes.

The protein sequence analysis reveals features consistent with ABC transporters, including transmembrane regions and nucleotide-binding domains. The presence of the sequence "GANGSGKTTLMLILAG" and other similar motifs in the amino acid sequence suggests the presence of Walker A and Walker B motifs, which are characteristic of ATP-binding proteins . These motifs are crucial for the ATP-binding and hydrolysis activities that power substrate transport.

Research Gaps and Future Directions

Several key questions remain unanswered regarding Mb2353c:

  1. What specific substrates does this transporter recognize and transport?

  2. What is its role in M. bovis physiology and potential involvement in pathogenesis?

  3. How does its function compare to homologous proteins in related mycobacterial species?

  4. Could it serve as a potential target for antimycobacterial interventions?

Addressing these questions would require comprehensive biochemical, structural, and functional studies using the recombinant protein as a starting point.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
BQ2027_MB2353C; Uncharacterized ABC transporter ATP-binding protein Mb2353c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-697
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2353C
Target Protein Sequence
MCCAVCGPEPGRIGEVTPLGPCPAQHRGGPLRPSELAQASVMAALCAVTAIISVVVPFAA GLALLGTVPTGLLAYRYRLRVLAAATVAAGMIAFLIAGLGGFMGVVHSAYIGGLTGIVKR RGRGTPTVVVSSLIGGFVFGAAMVGMLAAMVRLRHLIFKVMTANVDGIAATLARMHMQGA AADVKRYFAEGLQYWPWVLLGYFNIGIMIVSLIGWWALSRLLERMRGIPDVHKLDPPPGD DVDALIGPVPVRLDKVRFRYPRAGQDALREVSLDVRAGEHLAIIGANGSGKTTLMLILAG RAPTSGTVDRPGTVGLGKLGGTAVVLQHPESQVLGTRVADDVVWGLPLGTTADVGRLLSE VGLEALAERDTGSLSGGELQRLALAAALAREPAMLIADEVTTMVDQQGRDALLAVLSGLT QRHRTALVHITHYDNEADSADRTLSLSDSPDNTDMVHTAAMPAPVIGVDQPQHAPALELV GVGHEYASGTPWAKTALRDINFVVEQGDGVLIHGGNGSGKSTLAWIMAGLTIPTTGACLL DGRPTHEQVGAVALSFQAARLQLMRSRVDLEVASAAGFSASEQDRVAAALTVVGLDPALG ARRIDQLSGGQMRRVVLAGLLARAPRALILDEPLAGLDAASQRGLLRLLEDLRRARGLTV VVVSHDFAGMEELCPRTLHLRDGVLESAAASEAGGMS
Uniprot No.

Target Background

Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of ABC transporter proteins like Mb2353c?

ABC (ATP-binding cassette) transporters are multidomain integral membrane proteins found across all phyla. They utilize ATP hydrolysis energy to translocate various solutes across cellular membranes. The Mb2353c protein belongs to this superfamily, containing the characteristic nucleotide-binding domains with conserved motifs for ATP binding and hydrolysis. The protein features multiple transmembrane domains that form the translocation pathway across the membrane .

The full-length Mb2353c protein consists of 697 amino acids and contains the classic ABC transporter motifs, including:

  • Conserved motif A (nucleotide binding): Typically contains the sequence GxxGxGKS/T

  • Conserved motif B (magnesium chelation): Contains aspartic acid and/or glutamic acid residues

  • Conserved motif C: Involved in ATP hydrolysis with characteristic K-containing sequence

What are the conserved domains in Mb2353c and how do they compare to other ABC transporters?

The Mb2353c protein contains three key conserved domains typical of ABC transporters:

  • Motif A (also called Walker A or P-loop): This domain contains the sequence pattern similar to GxxGxGKS/T that directly interacts with the phosphate groups of ATP. In similar proteins, the invariant lysine (K) residue makes direct contact with the β and γ phosphates of ATP .

  • Motif B (Walker B): Contains acidic residues (D/E) that coordinate Mg²⁺, which complexes with the β and γ phosphates of ATP. The first aspartic acid typically interacts with a magnesium ion via a water molecule .

  • Motif C: Contains a conserved lysine (K) residue and appears to be involved in ATP hydrolysis. This motif is characteristic of helicase superfamily III, which includes picornavirus-like (2C-like) proteins .

Mutation studies on similar proteins have shown that substitutions in the A and B motifs severely impair both ATP binding and hydrolysis, while mutations in the C motif may affect hydrolysis but not binding .

How should I properly store and reconstitute recombinant Mb2353c protein?

For optimal preservation of recombinant Mb2353c protein activity, follow these research-validated storage and reconstitution protocols:

Storage Protocol:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom

  • Store the lyophilized powder at -20°C/-80°C

  • For working stock, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

Reconstitution Protocol:

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Prepare multiple small aliquots for long-term storage at -20°C/-80°C

  • For buffer conditions, Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been validated for stability

These protocols ensure maximal retention of protein structure and enzymatic activity for downstream experimental applications.

What methods can be used to assess ATP binding activity of Mb2353c?

Several validated methodologies can be employed to characterize the ATP binding activity of recombinant Mb2353c:

UV Cross-linking Assay:

  • Incubate purified protein with [α-³²P]ATP in appropriate buffer

  • Expose the mixture to UV light to induce photolysis, resulting in covalent bonds between the protein and labeled ATP

  • Analyze the protein-nucleotide complexes by SDS-PAGE followed by autoradiography

  • For competition assays, include varying concentrations of unlabeled nucleotides

  • Analyze in both Mg²⁺-containing and Mg²⁺-free conditions to assess the role of this ion

Nucleotide Preference Analysis:

  • Perform competition binding assays using various unlabeled nucleotides (ATP, GTP, CTP, UTP) and their deoxy forms

  • Establish a hierarchy of binding affinities for different nucleotides

  • Analyze purine versus pyrimidine preferences

Research with similar ABC transporters indicates that a fivefold reduction in binding capacity occurs in the absence of Mg²⁺, demonstrating the critical role of this ion in nucleotide binding .

What approaches can be used to measure the ATPase activity of Mb2353c?

For quantitative assessment of the ATPase activity of recombinant Mb2353c, the following methodological approach is recommended:

Colorimetric Phosphate Release Assay:

  • Incubate purified protein with ATP in appropriate buffer containing Mg²⁺

  • Measure the release of inorganic phosphate (Pi) using a colorimetric method such as malachite green assay

  • For competition studies, include unlabeled nucleotides at defined molar ratios to determine substrate specificity

  • Perform kinetic analysis by varying ATP concentration and measuring initial reaction rates

  • Calculate important enzymatic parameters such as Vmax and Km

Analysis of Nucleotide Preferences:
To establish the nucleotide preference profile, perform the ATPase assay in the presence of competing nucleotides. Based on studies with similar ABC transporters, you might expect to observe:

  • Strong competition with ATP by dATP (91% inhibition of Pi release)

  • Strong competition with GTP (53% inhibition)

  • Weak competition with pyrimidine nucleotides like CTP (3% inhibition)

  • Intermediate effects with nucleotides like dGTP (38% inhibition)

These methodological approaches will provide a comprehensive characterization of the ATPase activity and nucleotide preference profile of the recombinant Mb2353c protein.

How can I design site-directed mutagenesis experiments to investigate the functional motifs of Mb2353c?

Site-directed mutagenesis represents a powerful approach to probe the structure-function relationships in ABC transporters like Mb2353c. Based on established methodologies, consider this strategic framework:

Target Selection Strategy:

  • Prioritize highly conserved residues in motifs A, B, and C for mutagenesis

  • Design two categories of mutations:

    • Non-conservative substitutions: Replace residues with amino acids never found at that position in any ABC transporter (e.g., G→I, T→A, D→L, K→Q)

    • Conservative substitutions: Replace residues with similar amino acids found in related proteins (e.g., T→S, E→D)

Key Residues to Target in Mb2353c:

  • In motif A (GxxGxGKS/T): The glycine residue and the terminal threonine/serine

  • In motif B (DD/E): The acidic residues (aspartate and glutamate)

  • In motif C (K-containing motif): The conserved lysine residue

Functional Impact Assessment:
After generating the mutants, analyze both ATP binding (using UV cross-linking) and ATP hydrolysis (using phosphate release assays) to comprehensively characterize the impact of each mutation.

Based on similar studies, expect these potential outcomes:

  • Non-conservative mutations in motifs A and B will likely abolish both binding and hydrolysis

  • Some conservative mutations (like T→S in motif A) may severely impact activity despite the structural similarity

  • Mutations in motif C may affect hydrolysis but not binding

How does Mg²⁺ influence the ATP binding and hydrolysis by Mb2353c?

The role of Mg²⁺ in ABC transporter function is critical but often overlooked in experimental design. Comprehensive characterization of Mb2353c should include analysis of Mg²⁺ dependence:

Experimental Approach:

  • Perform ATP binding assays (UV cross-linking) with and without Mg²⁺

  • Conduct ATP hydrolysis assays across a range of Mg²⁺ concentrations

  • Analyze binding kinetics in the presence and absence of this divalent cation

Expected Observations:
Based on studies with similar ABC transporters:

  • ATP binding capacity is typically reduced approximately fivefold in the absence of Mg²⁺

  • The B motif of ABC transporters contains acidic residues that coordinate Mg²⁺

  • The first aspartic acid residue in motif B interacts with a magnesium ion via a water molecule

  • This magnesium ion forms a complex with the β and γ phosphates of ATP

Understanding this relationship is crucial for accurate interpretation of binding and hydrolysis data, as experimental conditions that chelate or exclude Mg²⁺ may significantly underestimate the protein's true activity.

What is the nucleotide preference profile of Mb2353c and how can it be determined?

Understanding the nucleotide preference profile of Mb2353c provides critical insights into its physiological function and substrate specificity:

Methodological Approach:

  • Perform ATP binding assays (UV cross-linking with [α-³²P]ATP) in the presence of competing unlabeled nucleotides

  • Conduct ATPase activity assays with various nucleotides as substrates

  • Use competition assays to determine relative affinities for different nucleotides

Expected Pattern Based on Similar ABC Transporters:
The following hierarchy of nucleotide preference might be observed:

  • Purines (ATP, dATP) generally show the highest affinity

  • GTP and dGTP often show intermediate binding

  • Pyrimidines (CTP, UTP, dCTP, dTTP) typically show lower affinity

In quantitative terms, the inhibition of labeled ATP binding might follow this pattern:

  • ATP, dATP: 89-91% inhibition

  • GTP: ~53% inhibition

  • dGTP: ~38% inhibition

  • UTP, dCTP, dTTP: 17-23% inhibition

  • CTP: Minimal inhibition (~3%)

This preference for purine nucleotides appears to be a common characteristic among ABC transporters and may reflect their evolutionary history and functional specialization.

How can I resolve data-model conflicts when the experimental results for Mb2353c differ from computational predictions?

When experimental data for Mb2353c contradicts computational models or predictions, a systematic diagnostic approach is essential:

Methodological Framework for Conflict Resolution:

  • Decompose the data-model evaluation process into functional components

  • Enumerate possible causes of the conflict

  • Collect relevant metadata about the computational process

  • Evaluate evidence to identify the most likely causes of the discrepancy

Common Sources of Data-Model Conflicts:

  • Experimental limitations (protein purity, assay sensitivity)

  • Model assumptions that don't apply to this specific ABC transporter

  • Contextual differences between the computational model and experimental conditions

  • Metadata gaps leading to misinterpretation of computational results

Diagnostic Approach:

  • Apply Bayesian belief networks to represent dependencies between evidence and possible causes

  • Use the process model to direct acquisition of relevant metadata

  • Generate evidence from the metadata to populate the diagnostic network

  • Perform inference on the network to identify the most probable explanation

This approach bridges the "contextual rift" that often develops when researchers use computational tools, models, or data from diverse sources without full awareness of their original context and limitations.

What role does the C motif play in Mb2353c function and how does it differ from the A and B motifs?

The C motif of ABC transporters represents an intriguing domain with distinct functional characteristics compared to the well-characterized A and B motifs:

Functional Distinction:
While motifs A and B are directly involved in ATP binding, the C motif appears to play a more specialized role in the hydrolysis process. Experimental evidence with similar proteins reveals:

MotifPrimary FunctionEffect of Non-Conservative Mutation on BindingEffect on ATPase Activity
AATP bindingDramatic decreaseComplete abolishment
BMg²⁺ coordinationDramatic decreaseComplete abolishment
CATP hydrolysisNo significant effectVaries by position

Experimental Evidence:
Mutation studies on the conserved lysine in motif C (K600Q in similar proteins) showed:

  • No detectable impact on ATP binding capacity

  • Retention of wild-type level ATPase activity

This clearly distinguishes the C motif from the A and B motifs, where equivalent mutations abolish both binding and hydrolysis.

Research Implications:
This functional separation suggests distinct roles in the catalytic cycle of ATP hydrolysis, with the C motif potentially involved in later stages of the process such as phosphate release or conformational changes following hydrolysis rather than the initial binding events.

How do conservative versus non-conservative mutations in Mb2353c differ in their impact on protein function?

The differential impact of conservative versus non-conservative mutations provides crucial insights into the structural tolerance and functional requirements of different domains within Mb2353c:

Comparative Impact Analysis:

Mutation TypeExampleLocationEffect on ATP BindingEffect on ATPase Activity
Non-conservativeG→IMotif ADramatic decreaseComplete abolishment
Non-conservativeT→AMotif ADramatic decreaseComplete abolishment
Non-conservativeD→LMotif BDramatic decreaseComplete abolishment
Non-conservativeK→QMotif CNo significant effectNo significant effect
ConservativeT→SMotif AModerate decreaseSevere loss (12-15% of wild-type)
ConservativeE→DMotif BModerate decreasePartial loss (~50% of wild-type)

Unexpected Findings:
The most striking observation is that seemingly conservative changes can have profound functional effects. For example, the threonine-to-serine substitution in motif A (T→S) results in retention of only 12-15% of wild-type ATPase activity despite maintaining similar chemical properties .

Research Implications:
These findings highlight the exquisite structural specificity of ABC transporters, where even minimal alterations in side chain architecture can significantly impact function. This suggests:

  • The three-dimensional positioning of key residues is precisely optimized for catalysis

  • Even conservative substitutions can alter critical geometric relationships

  • Functional tolerance varies significantly across different motifs

This differential impact should guide the design and interpretation of mutagenesis experiments on Mb2353c.

What is the optimal expression system for producing functionally active recombinant Mb2353c?

For producing research-grade recombinant Mb2353c with high functional activity, the expression system selection is crucial:

Recommended Expression System:
E. coli has been validated as an effective expression host for recombinant Mb2353c, particularly when the protein is fused to an N-terminal His-tag or GST tag to facilitate purification .

Key Expression Parameters:

  • Vector selection: Vectors with strong inducible promoters (T7, tac)

  • Host strain: BL21(DE3) or derivatives optimized for membrane protein expression

  • Induction conditions: Lower temperatures (16-25°C) often improve folding

  • Fusion tags: N-terminal His-tag enables single-step purification by immobilized metal affinity chromatography

  • Solubilization: Careful detergent selection for membrane-associated domains

Purification Considerations:
The recombinant protein should be purified to >90% homogeneity as determined by SDS-PAGE to ensure reliable functional characterization. Current protocols achieve this benchmark through affinity chromatography followed by size exclusion chromatography if needed .

How can I troubleshoot low ATPase activity in purified Mb2353c preparations?

When encountering unexpectedly low ATPase activity in purified Mb2353c preparations, a systematic troubleshooting approach is recommended:

Methodological Troubleshooting Framework:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE (check for degradation)

    • Confirm purity (>90% homogeneity)

    • Analyze oligomeric state by size exclusion chromatography

  • Buffer Optimization:

    • Ensure optimal pH (typically 7.5-8.0 for ABC transporters)

    • Verify Mg²⁺ concentration (typically 2-5 mM)

    • Test different buffering agents (Tris, HEPES, phosphate)

    • Assess the impact of ionic strength

  • Assay Conditions Verification:

    • Temperature optimization (typically 25-37°C)

    • Time course analysis to ensure linearity

    • Substrate concentration optimization

    • Consider adding potential stimulatory lipids or co-factors

  • Protein Refolding Assessment:

    • Test mild detergents to improve protein conformation

    • Consider gradual removal of denaturants if refolding is necessary

    • Evaluate thermal stability using differential scanning fluorimetry

  • Storage Impact:

    • Analyze the effect of freeze-thaw cycles

    • Test fresh preparations versus stored samples

    • Consider adding stabilizing agents (glycerol, trehalose)

This systematic approach should identify the critical factor limiting enzymatic activity and guide appropriate adjustments to experimental protocols.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.