Recombinant Uncharacterized ABC transporter ATP-binding protein Rv1819c/MT1867 (Rv1819c, MT1867)

Shipped with Ice Packs
In Stock

Description

Substrate Transport

  • Transports structurally unrelated hydrophilic molecules:

    • Cobalamin (Vitamin B₁₂): Essential for Mtb growth in methionine-deficient conditions .

    • Bleomycin: Antimicrobial peptide linked to drug resistance modulation .

  • Functional assays confirm uptake activity in E. coli knockout strains, restoring growth in cobalamin-dependent conditions .

ATPase Activity

  • Exhibits basal ATP hydrolysis activity (~50 nmol/min/mg) not stimulated by substrates .

  • ATP-binding stabilizes the transporter in an inward-facing conformation, facilitating substrate release into the cytosol .

Role in Tuberculosis Pathogenesis

  • Cobalamin Uptake: Linked to Mtb survival in host environments, particularly under methionine starvation .

  • Drug Resistance: Mediates bleomycin transport, suggesting a role in antibiotic susceptibility .

Therapeutic Potential

  • Structural insights into Rv1819c’s cavity and ATPase mechanism provide targets for inhibitor design .

  • Gene essentiality in cobalamin uptake highlights its importance for Mtb virulence .

Cryo-EM Structures

  • 6TQF (AMP-PNP bound): Captures the inward-facing conformation with Mg–AMP-PNP bound at NBDs .

  • 6TQE (apo state): Reveals nucleotide-free conformation, aiding mechanistic studies .

Functional Validation

  • Complementation of E. coli ΔFEC (cobalamin auxotrophy) and JW0368 (bleomycin sensitivity) confirms dual-substrate transport .

  • ATPase assays demonstrate constitutive activity, atypical for ABC importers .

Open Questions and Future Directions

  • Substrate Range: Whether Rv1819c transports additional hydrophilic solutes remains unexplored .

  • Regulatory Mechanisms: Transcriptional control via cis-regulatory motifs (e.g., bicluster_0003/0049) requires validation .

  • In Vivo Role: Direct evidence linking Rv1819c to Mtb pathogenicity in animal models is lacking .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet customer requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-639
Protein Length
full length protein
Target Names
Rv1819c, MT1867
Target Protein Sequence
MGPKLFKPSIDWSRAFPDSVYWVGKAWTISAICVLAILVLLRYLTPWGRQFWRITRAYFV GPNSVRVWLMLGVLLLSVVLAVRLNVLFSYQGNDMYTALQKAFEGIASGDGTVKRSGVRG FWMSIGVFSVMAVLHVTRVMADIYLTQRFIIAWRVWLTHHLTQDWLDGRAYYRDLFIDET IDNPDQRIQQDVDIFTAGAGGTPNAPSNGTASTLLFGAVQSIISVISFTAILWNLSGTLN IFGVSIPRAMFWTVLVYVFVATVISFIIGRPLIWLSFRNEKLNAAFRYALVRLRDAAEAV GFYRGERVEGTQLQRRFTPVIDNYRRYVRRSIAFNGWNLSVSQTIVPLPWVIQAPRLFAG QIDFGDVGQTATSFGNIHDSLSFFRNNYDAFASFRAAIIRLHGLVDANEKGRALPAVLTR PSDDESVELNDIEVRTPAGDRLIDPLDVRLDRGGSLVITGRSGAGKTTLLRSLAELWPYA SGTLHRPGGENETMFLSQLPYVPLGTLRDVVCYPNSAAAIPDATLRDTLTKVALAPLCDR LDEERDWAKVLSPGEQQRVAFARILLTKPKAVFLDESTSALDTGLEFALYQLLRSELPDC IVISVSHRPALERLHENQLELLGGGQWRLAPVEAAPAEV
Uniprot No.

Q&A

What is the Rv1819c/MT1867 protein and what is its function in Mycobacterium tuberculosis?

Rv1819c is an ABC transporter in Mycobacterium tuberculosis involved in the uptake of hydrophilic molecules. The protein exhibits ATPase activity which is crucial for its transport function. When reconstituted in liposomes, Rv1819c shows a basal ATPase activity of 0.53 ± 0.12 μmol ATP s−1 per μmol protein at an Mg–ATP concentration of 10 mM. This activity is significantly higher (approximately fivefold) when the protein is in dodecyl-β-d-maltopyranoside (DDM) solution, reaching 2.94 ± 0.19 μmol ATP s−1 per μmol protein .

The transporter's function depends on ATP hydrolysis, as demonstrated by mutations in the Walker B motif. When Glu576 is mutated to Gly (E576G), the protein is still produced at the same level as the wild-type but exhibits only background ATPase activity of 0.11 ± 0.03 μmol ATP s−1 per μmol protein and cannot support substrate transport .

How does the structure of Rv1819c relate to its transport mechanism?

The structure of Rv1819c reveals a cavity lined with polar and negatively charged residues, making it favorable for interactions with hydrophilic molecules. This structural feature is consistent with its role in transporting hydrophilic substrates across the mycobacterial membrane .

For transport to occur, the cavity must become accessible to both sides of the membrane in an alternating manner. Structural studies suggest that the cytoplasmic gate of Rv1819c opens upon ATP hydrolysis and phosphate release, allowing the nucleotide-binding domains (NBDs) to dissociate . This conformational change creates an alternating access mechanism, similar to other ABC transporters, where substrates can be moved across the membrane barrier.

Comparison with other ABC exporters such as McjD and Sav1866 shows that differences in the positions of transmembrane helices (TMH1 and TMH2) at the level of the outer leaflet of the lipid bilayer lead to the formation of either a cavity of different size (as in Rv1819c and McjD) or separate lobes that provide access to the bilayer environment (as in Sav1866) .

What expression systems are recommended for producing recombinant Rv1819c protein?

While E. coli is commonly used for heterologous protein expression, the success rate of obtaining soluble mycobacterial proteins from E. coli host cells is suboptimal, with only about one-third of proteins being produced in soluble and properly folded form .

Mycobacterium smegmatis has emerged as an effective alternative expression host for mycobacterial proteins, including ABC transporters like Rv1819c. T7 promoter-based vectors, such as pYUB1049 and pYUB1062 shuttle vectors, have been developed specifically for protein expression in M. smegmatis host cells . These vectors allow expression and solubility trials to be conducted in parallel in both E. coli and M. smegmatis.

The M. smegmatis mc 24517 strain is particularly useful as it contains a copy of T7 RNA polymerase integrated into the chromosome under control of the acetamidase promoter. Expression can be induced using acetamide, lactose, or IPTG in this system . This strain is compatible with T7 promoter-based vectors and has proven valuable for expressing mycobacterial membrane proteins.

How can site-directed mutagenesis be used to study the ATP hydrolysis mechanism in Rv1819c?

Site-directed mutagenesis of conserved motifs in the nucleotide-binding domains provides valuable insights into the ATP hydrolysis mechanism of Rv1819c. The most informative approach involves targeting the Walker B motif, which is critical for ATP hydrolysis in ABC transporters .

Mutation of Glu576 to Gly (E576G) in the Walker B motif blocks ATPase activity completely while maintaining protein expression levels similar to wild-type. This mutation allows researchers to trap the transporter in specific conformations for structural analysis. Interestingly, the E576G mutant captures cellular Mg–ATP during protein production without hydrolyzing it, and the nucleotide remains bound during purification procedures .

This behavior differs from Walker B mutations in other ABC transporters, such as BtuCDF, where some residual activity is often retained. Using this mutant in combination with non-hydrolyzable ATP analogues like adenylyl-5′-(β,γ-imido)triphosphate (AMP-PNP) further stabilizes the protein in defined conformations, facilitating structural studies by techniques such as cryo-EM or X-ray crystallography .

What strategies exist for producing antibodies against membrane-embedded epitopes of Rv1819c?

Generating antibodies against membrane proteins like Rv1819c is challenging due to their hydrophobic nature and complex folding. Recent research has successfully produced antibodies against extra cytoplasmic loops of Rv1819c using the RAD display system .

In this approach, peptides derived from the exposed loops of Rv1819c are displayed on the RAD system and used for immunization of mice to produce polyclonal antibodies. These antibodies can recognize the transporter in both purified and membrane fractions, as demonstrated by western blot analysis showing recognition of a protein band of approximately 73.7 kDa in both fractions .

The effectiveness of this method appears to depend on the length and immunogenicity of the displayed peptides, with longer peptides (RAD-Rv1819c_L) inducing higher antibody levels than shorter ones. Immunogenicity prediction using the IEDB server can help identify the most promising peptide sequences for antibody production .

These antibodies serve as valuable tools for studying Rv1819c localization, exploring conformational changes, potentially inhibiting transport, and facilitating structural biology studies by increasing the effective size of the target protein for techniques like cryo-EM .

How do conformational changes in the nucleotide-binding domains of Rv1819c couple to substrate transport?

The mechanism by which ATP binding and hydrolysis drive substrate transport in Rv1819c involves coordinated conformational changes between the nucleotide-binding domains (NBDs) and the transmembrane domains (TMDs) .

When ATP binds to the Walker A motif in one NBD and the LSGGQ motif in the opposite NBD, it causes the NBDs to dimerize tightly. This dimerization transmits conformational changes to the TMDs, altering the accessibility of the substrate-binding cavity. The process is similar to that observed in the maltose ABC transporter (MalK), where ATP binds along the dimer interface, with the γ phosphate interacting with the Walker A motif, Q loop, and switch region histidine of one NBD and the LSGGQ motif of the other NBD .

Upon ATP hydrolysis and phosphate release, the NBDs dissociate, causing the cytoplasmic gate to open . This conformational cycle creates an alternating access mechanism that allows substrates to be transported across the membrane. The complete transport cycle likely involves multiple steps: ATP binding, NBD dimerization, substrate translocation, ATP hydrolysis, phosphate release, and return to the resting state.

What methods are optimal for assessing the ATPase activity of purified Rv1819c?

Two main approaches are used to measure the ATPase activity of Rv1819c: coupled enzyme assays and malachite green assays. Each has specific advantages depending on the experimental conditions .

The malachite green assay offers an alternative that is compatible with cobalamin and provides a qualitative assessment of ATPase activity. This colorimetric assay detects inorganic phosphate released during ATP hydrolysis and is useful for examining substrate effects on ATPase activity .

Research has shown that the environment significantly affects ATPase activity measurements. When in dodecyl-β-d-maltopyranoside (DDM) solution, Rv1819c shows approximately fivefold higher ATPase activity (2.94 ± 0.19 μmol ATP s−1 per μmol protein) compared to when reconstituted in liposomes (0.53 ± 0.12 μmol ATP s−1 per μmol protein) . This highlights the importance of standardizing conditions when comparing results across different studies.

What purification strategies are most effective for obtaining stable and functionally active Rv1819c?

Purification of Rv1819c for functional and structural studies requires careful consideration of several factors to maintain protein stability and activity. Based on successful approaches in the literature, the following strategy is recommended:

  • Expression system selection: M. smegmatis expression systems using T7 promoter-based vectors provide better yields of properly folded mycobacterial membrane proteins compared to E. coli .

  • Solubilization: Mild detergents like dodecyl-β-d-maltopyranoside (DDM) effectively solubilize Rv1819c while preserving its functional state .

  • Affinity purification: His-tagged constructs enable purification using immobilized metal affinity chromatography (IMAC). The inclusion of appropriate detergent in all buffers is critical to prevent aggregation .

  • Protein stabilization: For structural studies, using the E576G Walker B mutant in the presence of Mg–ATP or non-hydrolyzable ATP analogues like AMP-PNP helps trap the transporter in defined conformations .

  • Quality control: Assessing ATPase activity (using methods described in FAQ 7) provides a functional validation of the purified protein. Additionally, size-exclusion chromatography can verify protein homogeneity and lack of aggregation.

This approach has successfully yielded Rv1819c preparations suitable for both functional characterization and high-resolution structural studies .

How can antibodies against Rv1819c be used to study its localization and function in mycobacterial cells?

Antibodies raised against Rv1819c, particularly those targeting the extra cytoplasmic loops, provide powerful tools for studying this transporter in its native cellular context . These applications include:

  • Subcellular localization: Immunofluorescence microscopy using anti-Rv1819c antibodies can reveal the distribution of the transporter within mycobacterial cells, potentially identifying specific membrane domains where it concentrates.

  • Expression level monitoring: Western blotting with these antibodies allows quantification of Rv1819c expression under different growth conditions or in various mycobacterial strains, helping correlate expression with physiological states.

  • Conformational dynamics: If antibodies recognize conformation-specific epitopes, they can be used to track conformational changes associated with the transport cycle.

  • Transport inhibition: Antibodies binding to functionally important extracellular loops might interfere with substrate binding or transport, providing insights into the transport mechanism.

  • Protein-protein interactions: Immunoprecipitation with anti-Rv1819c antibodies could identify interaction partners that may regulate its function or localization.

Recent research has demonstrated that antibodies raised against RAD-displayed Rv1819c peptides successfully recognize the transporter (approximately 73.7 kDa) in both purified and membrane fractions in western blot analysis . This validates their utility for studying the native protein in experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.