Recombinant Uncharacterized FAM18-like protein C34D4.4 (C34D4.4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
C34D4.4; Uncharacterized Golgi apparatus membrane protein-like protein C34D4.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C34D4.4
Target Protein Sequence
MRTKAKISGAFPREKYGMQVRNRRKVCKQHTSRANSSTFPTKMSGFENDISIGATMTQSQ TSQGFSLQMFGKPTIVLAHLSFKGAALFFYFFANFFTNSFIVQFLVILTLLSMDFWTVKN ITGRLLVGLRWWNFVDADGNNHWKFESAKDMTRFATIDRRVFWLGLVVGPAAWIFFVVTA FLTLKFEWMIVALLGALMNMANLWGYLRCRWNNTEQMTSYFQKWAFLNVLRRAQQPPQEY QNPVFSA
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C34D4.4

STRING: 6239.C34D4.4a

UniGene: Cel.13386

Protein Families
TVP23 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is C34D4.4 and what experimental systems can be used to study it?

C34D4.4 is an uncharacterized FAM18-like protein found in Caenorhabditis elegans that has been identified as an essential gene through deletion studies . The protein consists of 247 amino acids and has been successfully expressed as a recombinant protein with appropriate tagging systems .

Several experimental systems can be employed to study this protein:

  • Expression systems: Recombinant C34D4.4 can be expressed in various hosts, with E. coli and yeast offering the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide necessary posttranslational modifications for correct protein folding or activity retention .

  • Genetic manipulation: CRISPR-Cas9 genome editing has been successfully used to generate deletion mutants of C34D4.4 in a wild-type background, providing a valuable tool for functional studies .

  • C. elegans models: As C34D4.4 originates from C. elegans, this model organism is ideal for in vivo functional studies through techniques such as RNAi knockdown or genetic deletion.

What are the optimal conditions for recombinant C34D4.4 protein expression?

Based on recombinant protein production studies, several factors influence optimal expression of proteins like C34D4.4:

Host SystemAdvantagesConsiderations
E. coliBest yields, shorter turnaround times, cost-effectiveLimited post-translational modifications
YeastGood yields, some post-translational modificationsSlightly longer production time than E. coli
Insect cellsBetter post-translational modificationsLower yields, longer production time
Mammalian cellsMost native-like post-translational modificationsLowest yields, longest production time

For E. coli expression specifically, accessibility of translation initiation sites is a critical factor in successful recombinant protein expression . Analysis of 11,430 recombinant protein production experiments revealed that the accessibility of translation initiation sites modeled using mRNA base-unpairing across the Boltzmann's ensemble significantly outperforms alternative features in predicting expression success .

Methodological approach:

  • Design expression constructs with optimal translation initiation site accessibility

  • Consider synonymous codon substitutions within the first nine codons to improve accessibility

  • Express initially in E. coli for rapid screening

  • If protein activity is compromised, transition to eukaryotic expression systems

How can CRISPR-Cas9 genome editing be optimized for studying C34D4.4 function?

CRISPR-Cas9 genome editing has been successfully employed to generate deletion mutants of C34D4.4 in C. elegans . Based on the documented approach, researchers should consider:

Methodological protocol for C34D4.4 deletion:

  • Guide RNA design: Use C. elegans-specific guide selection tools (e.g., genome.sfu.ca/crispr) to design guide RNAs targeting C34D4.4. Two guide RNAs were successfully used to excise the gene .

  • Repair template construction: Generate repair templates by assembling homology arms (450-bp gBlocks) and a selection cassette (e.g., loxP + Pmyo-2::GFP::unc-54 3′UTR + Prps-27::neoR::unc-543′UTR + loxP) using NEBuilder Hifi DNA Assembly Kit .

  • RNP complex assembly: Assemble Cas9 protein into a ribonucleoprotein complex with guide RNAs and tracrRNA following manufacturer's recommendations .

  • Microinjection: Inject animals using standard microinjection techniques with an injection mix consisting of:

    • 50 ng/µl repair template

    • 0.5 µM RNP complex

    • 5 ng/µl pCFJ104 (Pmyo-3::mCherry)

    • 2.5 ng/µl pCFJ90 (Pmyo-2::mCherry)

  • Screening and validation: Screen injected animals according to established protocols and validate genomic edits using PCR .

  • Complementation testing: Perform complementation tests between CRISPR-Cas9 deletion strains and legacy mutant strains to confirm gene identities .

This approach allows for systematic characterization of C34D4.4 function through genetic deletion and subsequent phenotypic analysis.

What quality control measures are essential for C34D4.4 protein reagent preparation?

Quality control of protein reagents is crucial for reproducible research with C34D4.4. Following best practices for protein quality control will ensure reliable experimental outcomes :

Essential QC measures for C34D4.4:

  • Purity assessment:

    • SDS-PAGE analysis (>90% purity recommended)

    • Size exclusion chromatography

    • Mass spectrometry to confirm molecular weight

  • Identity confirmation:

    • Western blotting using anti-His tag antibodies (for His-tagged constructs)

    • Mass spectrometry for peptide mapping

    • N-terminal sequencing

  • Structural integrity:

    • Circular dichroism spectroscopy

    • Thermal shift assays

    • Limited proteolysis

  • Functional characterization:

    • Binding assays with potential interacting partners

    • Activity assays (once function is determined)

  • Storage stability:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Long-term storage in 6% Trehalose, pH 8.0 buffer with 5-50% glycerol at -20°C/-80°C

Implementing these QC measures will significantly improve research reproducibility and data reliability when working with C34D4.4.

What factors influence the successful expression of recombinant C34D4.4 and how can they be optimized?

Recombinant protein expression success depends on multiple factors, especially for proteins like C34D4.4 that remain uncharacterized. Based on comprehensive analysis of 11,430 recombinant protein expression experiments, several key factors significantly impact success rates :

Critical factors affecting expression success:

  • mRNA structure and accessibility (strongest predictor):

    • The accessibility of translation initiation sites modeled using mRNA base-unpairing across the Boltzmann's ensemble significantly outperforms other features in predicting expression success

    • Lower opening energy (≤12 kcal/mol) at the translation initiation site strongly correlates with higher protein expression

  • Codon optimization (secondary importance):

    • While codon adaptation index (CAI) shows some correlation with expression, it's less predictive than mRNA accessibility

    • tRNA adaptation index (tAI) similarly shows weaker correlation than accessibility

  • Expression system selection:

    • E. coli and yeast offer best yields for initial characterization

    • Eukaryotic systems provide better post-translational modifications if needed for activity

Optimization strategies for C34D4.4 expression:

  • Improve mRNA accessibility:

    • Use synonymous substitutions in the first nine codons to reduce opening energy at translation initiation sites

    • Tools like TIsigner can be used to modify codons with synonymous substitutions to improve accessibility

  • Expression vector design:

    • Use T7lac inducible promoter systems (successfully used in PSI:Biology targets)

    • Consider C-terminal His tag for purification (shown to work for C34D4.4)

  • Host strain selection:

    • BL21(DE3) or derivatives for E. coli expression

    • Consider strains with additional tRNAs for rare codons if needed

  • Expression conditions optimization:

    • Test induction at different OD values

    • Optimize induction temperature (often lower temperatures improve solubility)

    • Consider co-expression with chaperones if solubility is an issue

Stochastic simulation models demonstrate that higher accessibility leads to higher protein production but slower cell growth, supporting the concept of protein cost where cell growth is constrained during overexpression .

What experimental approaches can be used to identify potential interaction partners of C34D4.4?

Given the uncharacterized nature of C34D4.4, identifying interaction partners is a crucial step toward understanding its function. Several complementary approaches can be employed:

In vitro interaction studies:

  • Pull-down assays: Using recombinant GST-tagged or His-tagged C34D4.4 as bait to capture interacting proteins from cell lysates

    • Example protocol: GST-tagged C34D4.4 can be immobilized on glutathione resin and incubated with cell lysates or plasma. Interacting proteins can then be eluted and identified by western blotting or mass spectrometry

  • Yeast two-hybrid (Y2H) screening:

    • Direct Y2H experiments can identify specific protein-protein interactions

    • A C34D4.4 "bait" construct can be screened against a C. elegans cDNA library

  • Stable isotope labeling by amino acids in cell culture (SILAC):

    • This approach, combined with mass spectrometry, can identify potential interaction partners with high confidence

    • SILAC has successfully identified novel protein interactions in related systems

In vivo interaction studies:

  • Co-immunoprecipitation:

    • Express tagged versions of C34D4.4 in C. elegans or cell culture

    • Immunoprecipitate complexes and identify interacting proteins by mass spectrometry

  • Proximity labeling:

    • Fusion of C34D4.4 with BioID or APEX2 to identify proximal proteins in living cells

    • This approach can capture transient interactions missed by other methods

  • Genetic interaction screening:

    • Synthetic genetic array analysis in yeast with C34D4.4 homologs

    • RNAi screening for genetic enhancers or suppressors of C34D4.4 phenotypes

Based on studies of related proteins, potential interactors may include chromatin remodeling proteins, as FAM124B (a different protein) was identified as an interacting partner of CHD7 and CHD8 . This suggests investigating whether C34D4.4 participates in similar complexes.

How can researchers effectively design experiments to characterize the function of an uncharacterized protein like C34D4.4?

Characterizing an uncharacterized protein requires a systematic, multi-disciplinary approach. For C34D4.4, the following experimental design strategy is recommended:

Comprehensive experimental design framework:

  • Sequence-based functional prediction:

    • Bioinformatic analysis for domain identification

    • Homology modeling to predict structure

    • Cross-species conservation analysis

  • Expression pattern analysis:

    • Tissue-specific expression using GFP/mCherry reporters

    • Developmental timing of expression

    • Subcellular localization studies

  • Loss-of-function studies:

    • CRISPR-Cas9 deletion mutants (already established for C34D4.4)

    • RNAi knockdown to identify phenotypes

    • Temperature-sensitive mutants for temporal control

  • Gain-of-function studies:

    • Overexpression analysis

    • Tissue-specific rescue experiments

    • Domain-specific mutant analysis

  • Protein-protein interaction mapping:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • SILAC approach as used for other uncharacterized proteins

Experimental design best practices:

When designing experiments for C34D4.4 characterization, follow these five key steps :

  • Define variables: Identify independent variables (e.g., expression conditions, interaction partners) and dependent variables (e.g., protein yield, binding affinity)

  • Formulate specific hypotheses: Based on preliminary data and bioinformatic predictions

  • Design treatments: Use appropriate controls and variable manipulations

  • Assign experimental groups: Use between-subjects or within-subjects designs as appropriate

  • Plan measurements: Define precise metrics for quantifying outcomes

How can contradictory data about C34D4.4 expression or function be reconciled through experimental design?

When faced with contradictory data regarding C34D4.4, a systematic approach to experimental design can help resolve discrepancies:

Methodological approach to reconciling contradictory data:

  • Standardize experimental conditions:

    • Ensure consistent protein expression systems across experiments

    • Use the same purification methods and buffer conditions

    • Implement rigorous quality control for protein reagents

  • Cross-validate with multiple techniques:

    • If functional data conflicts, employ orthogonal techniques to measure the same parameter

    • For example, validate protein-protein interactions using both Y2H and co-IP methods

  • Consider host-specific effects:

    • Expression in E. coli versus eukaryotic systems may yield proteins with different activities

    • Post-translational modifications present in one system but not another may account for functional differences

  • Examine expression efficiency influences:

    • Translation initiation site accessibility strongly impacts expression success

    • Different construct designs may have varying mRNA accessibilities, leading to expression level differences

  • Resolve genetic background effects:

    • In C. elegans studies, ensure consistent genetic backgrounds when comparing deletion mutants

    • Perform complementation tests to verify gene identities in different strains

Statistical considerations for resolving contradictions:

When analyzing contradictory data, employ the following statistical approaches:

  • Use meta-analysis techniques to combine results from multiple experiments

  • Perform sensitivity analyses to identify variables that contribute most to outcome variance

  • Apply Bayesian methods to update hypothesis probabilities given new evidence

  • Conduct power analyses to ensure adequate sample sizes for detecting effects

By implementing these methodological and statistical approaches, researchers can systematically address and resolve contradictory data regarding C34D4.4.

What are the key considerations in designing table-based data presentation for C34D4.4 research publications?

Effective presentation of C34D4.4 research data in tables requires careful consideration of structure, content, and formatting to maximize data comprehension:

Table design principles for C34D4.4 research:

  • Table structure and organization:

    • Present systematic overview of results to provide richer understanding of research findings

    • First table should summarize key characteristics of study population/samples

    • Subsequent tables should present details of associations/comparisons between variables

  • Content elements:

    • Title/legend should be concise but sufficiently informative

    • First column generally lists independent variables in rows

    • Subsequent columns present dependent data

    • Include column and row headings with group sizes and measurement units

  • Statistical presentation:

    • List numerical definitions appropriately: median ± SD for normal distribution, median with IQR for non-normally distributed data, or percentages for dichotomous data

    • Use fewest decimal points necessary for accurate reporting

    • Include statistical analysis and significance (P values) to highlight key findings

Do's and Don'ts for table presentation:

Do'sDon'ts
Reorient table (portrait to landscape) for better presentation of data if necessaryDon't make crowded tables - avoid non-essential data/rows/columns
Use footnotes for single data point/similar values or statistically significant P valuesDon't make tables too large or complicated to follow
Provide definitions of each abbreviation in the table legend or footnoteDon't repeat information from text
Use consistent elements (uniform font/frame/box) for all tablesDon't include simple data in tables that could be incorporated into text

To maximize the impact of C34D4.4 research publications, tables should be designed to present complex data clearly and concisely, allowing readers to quickly grasp key findings while providing sufficient detail for critical evaluation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.