Recombinant Uncharacterized HTH-type transcriptional regulator Mb1846 (Mb1846)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
BQ2027_MB1846; Uncharacterized HTH-type transcriptional regulator Mb1846
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1846
Target Protein Sequence
MCQTCRVGKRRDAREQIEAKIVELGRRQLLDHGAAGLSLRAIARNLGMVSSAVYRYVSSR DELLTLLLVDAYSDLADTVDRARDDTVADSWSDDVIAIARAVRGWAVTNPARWALLYGSP VPGYHAPPDRTAGVATRVVGAFFDAIAAGIATGDIRLTDDVAPQPMSSDFEKIRQEFGFP GDDRVVTKCFLLWAGVVGAISLEVFGQYGADMLTDPGVVFDAQTRLLVAVLAEH
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Mb1846 and which family of transcriptional regulators does it belong to?

Mb1846 is an uncharacterized helix-turn-helix (HTH) type transcriptional regulator. Based on structural analysis, HTH transcriptional regulators can be classified into families according to common 3D structural motifs, conserved domains, and primary sequences . Mb1846 likely belongs to a subfamily of bacterial transcriptional regulators that contain the characteristic HTH DNA-binding domain.

When studying uncharacterized HTH-type regulators like Mb1846, it's important to note that family assignment should not be based solely on the HTH region, as this lacks discriminatory potential. For example, profiles such as PROSITE PS51077 and SMART SM00346 include nondiscriminatory HTH regions, which can lead to incorrect family assignments . A comprehensive analysis of the full protein sequence, including both the DNA-binding domain and any additional domains, is necessary for accurate classification.

How does structural characterization inform the functional understanding of HTH-type transcriptional regulators like Mb1846?

Structural characterization of HTH-type transcriptional regulators provides critical insights into their DNA-binding mechanisms and regulatory functions. The helix-turn-helix motif typically comprises two α-helices connected by a short turn, with one helix (the recognition helix) interacting directly with the major groove of DNA.

For many HTH-type regulators, tetramerization plays a key role in their function. As observed with other HTH regulators, specific amino acid residues (such as Gly151 in some IclR family members) can be critical for tetramerization when the protein is bound to DNA . This oligomerization state often affects the protein's DNA-binding affinity and specificity.

Methodologically, researchers should employ multiple structural analysis techniques including X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, and cryo-electron microscopy to fully characterize the structure of Mb1846. Computational approaches such as homology modeling can provide preliminary structural insights when experimental data is limited.

What experimental techniques are most effective for initial characterization of uncharacterized transcriptional regulators like Mb1846?

For initial characterization of uncharacterized transcriptional regulators like Mb1846, a multi-technique approach is recommended:

  • Protein Expression and Purification: Optimize expression in E. coli using tags that minimize interference with protein folding and function. Purification should aim for >95% purity for subsequent structural and functional studies.

  • DNA-Binding Assays: Employ electrophoretic mobility shift assays (EMSAs) and fluorescence anisotropy to determine if Mb1846 binds DNA and under what conditions.

  • Transcriptional Reporter Assays: Use reporter systems (e.g., lacZ fusion constructs) to assess the regulatory effect (activation or repression) of Mb1846 on potential target promoters.

  • Sequence Analysis: Perform comparative genomics to identify conserved regions that might indicate functional domains or regulatory motifs, comparing Mb1846 to characterized HTH-type regulators .

  • Protein-Protein Interaction Studies: Use pull-down assays or bacterial two-hybrid systems to identify potential protein partners, as many transcriptional regulators function in complexes with other proteins.

How might Mb1846 influence nucleoid structure and gene expression in bacteria?

Transcriptional regulators like Mb1846 can significantly impact nucleoid structure and gene expression through multiple mechanisms. Based on studies of other HTH-type nucleoid-associated proteins (NAPs), Mb1846 may function through one or more of the following mechanisms:

  • Occlusion of RNA polymerase binding: Mb1846 might bind to promoter regions or transcription start sites, thereby preventing RNA polymerase from initiating transcription .

  • Blocking RNA polymerase progression: Alternatively, it may allow RNA polymerase binding and transcription initiation but block progression, acting as a roadblock protein .

  • Alteration of DNA topology: Like other transcriptional regulators, Mb1846 may induce changes in DNA supercoiling. Negative supercoiling facilitates DNA unwinding, promoting transcription initiation and inhibiting termination, while positive supercoiling has opposite effects .

  • Formation of higher-order nucleoprotein complexes: Similar to HU proteins, Mb1846 might bend DNA and form higher-order nucleoprotein complexes at promoters, stabilizing dense structures that affect transcription initiation .

  • Interaction with other regulatory proteins: It may work in concert with other transcriptional regulators in complex regulatory networks, as seen with Fis, H-NS, and other NAPs that simultaneously engage in regulation .

When designing experiments to investigate these potential mechanisms, researchers should consider using techniques like soft X-ray tomography to visualize nucleoid structure changes, similar to studies performed with HU variants .

What methodologies are recommended for identifying the DNA-binding motif of Mb1846?

Identifying the DNA-binding motif of an uncharacterized transcriptional regulator like Mb1846 requires a systematic approach:

Experimental Methods:

  • ChIP-seq (Chromatin Immunoprecipitation followed by sequencing): This technique allows genome-wide identification of binding sites. Anti-Mb1846 antibodies or epitope-tagged versions of Mb1846 can be used to immunoprecipitate Mb1846-DNA complexes, followed by sequencing to identify binding regions .

  • SELEX (Systematic Evolution of Ligands by Exponential Enrichment): This in vitro method involves iterative selection of oligonucleotides that bind with high affinity to Mb1846, followed by sequencing to identify consensus binding motifs.

  • DNase I footprinting: This technique identifies specific DNA sequences protected by Mb1846 binding from DNase I digestion.

Data Analysis Methods:

  • Motif Discovery Algorithms: Tools like MEME, HOMER, or STREME should be employed to analyze ChIP-seq or SELEX data and identify enriched sequence motifs.

  • Position Weight Matrix (PWM) Construction: PWMs representing the binding preference of Mb1846 should be created from identified motifs.

  • Cross-validation: Identified motifs should be validated by comparing with binding sites of related HTH-type transcriptional regulators, particularly those within the same subfamily.

Validation Methods:

  • Mutational Analysis: Introducing mutations in the predicted binding motif should reduce or eliminate Mb1846 binding in vitro.

  • Reporter Assays: Constructing reporter gene fusions with promoters containing wild-type or mutated binding sites can confirm the functional relevance of identified motifs.

How can researchers differentiate between direct and indirect regulatory effects of Mb1846?

Differentiating between direct and indirect regulatory effects is crucial for understanding the precise role of Mb1846 in gene regulation:

Methodological Approach:

  • Integrated ChIP-seq and RNA-seq Analysis: Perform ChIP-seq to identify Mb1846 binding sites and RNA-seq to measure gene expression changes upon Mb1846 deletion or overexpression. Genes that show both Mb1846 binding and expression changes are likely direct targets.

  • Time-course Analysis: Implement a time-resolved approach after induction or repression of Mb1846 expression. Direct targets typically show more rapid expression changes than indirect targets.

  • In vitro Transcription Assays: Reconstitute transcription with purified components (RNA polymerase, Mb1846, and template DNA containing putative Mb1846 binding sites) to directly assess whether Mb1846 affects transcription without cellular cofactors.

  • Transcription Factor Binding Site Mutations: Introduce specific mutations in predicted Mb1846 binding sites and measure their effect on gene expression in vivo. Loss of regulation with binding site mutations indicates direct regulation.

Analysis Framework:

Type of EvidenceDirect RegulationIndirect Regulation
ChIP-seq bindingPresent near regulated geneMay be absent
Response timingRapid (minutes)Delayed (hours)
Binding site mutationsAbolish regulationNo effect on regulation
In vitro transcriptionMb1846 alone affects transcriptionRequires additional factors
Protein-DNA interactionDetectable by EMSA or similar methodsNot detectable

What expression systems are optimal for producing recombinant Mb1846 for structural and functional studies?

Selecting the appropriate expression system for Mb1846 is critical for obtaining functional protein for downstream studies:

Prokaryotic Expression Systems:

Expression Optimization Strategies:

  • Fusion Tags: Consider testing multiple fusion tags:

    • His6-tag: Suitable for metal affinity purification

    • GST-tag: May enhance solubility but is bulky

    • SUMO-tag: Often improves solubility while allowing tag removal without residual amino acids

  • Induction Parameters:

    • Temperature: Test expression at 16°C, 25°C, and 37°C

    • Inducer concentration: Optimize IPTG concentration (0.1-1.0 mM) or use auto-induction media

    • Duration: Compare short (4-6h) versus long (overnight) induction periods

  • Codon Optimization: Analyze rare codon usage in Mb1846 sequence and consider codon optimization or expression in Rosetta strains that supply rare tRNAs.

Purification Strategy:

Design a two-step purification protocol:

  • Affinity chromatography (Ni-NTA for His-tagged protein)

  • Size exclusion chromatography to separate monomeric from oligomeric forms and remove aggregates

The purified protein should be evaluated for proper folding using circular dichroism before proceeding to functional assays.

How should researchers design ChIP-seq experiments to study genome-wide binding of uncharacterized regulators like Mb1846?

Designing effective ChIP-seq experiments for uncharacterized regulators requires careful consideration of several factors:

Experimental Design Considerations:

  • Antibody Selection/Generation:

    • Generate specific antibodies against purified recombinant Mb1846

    • Alternatively, express epitope-tagged Mb1846 (e.g., FLAG, HA, or V5) in the native organism, preferably from the endogenous locus

  • Growth Conditions:

    • Test multiple conditions to capture different regulatory states (e.g., different growth phases, stress conditions)

    • Include appropriate controls (e.g., input DNA, immunoprecipitation with non-specific antibodies)

  • Crosslinking Optimization:

    • Formaldehyde concentration (0.5-1%) and time (5-20 minutes) should be optimized

    • For transient interactions, consider using protein-protein crosslinkers in addition to formaldehyde

  • Sonication Parameters:

    • Optimize sonication conditions to achieve DNA fragments of 200-500 bp

    • Verify fragment size distribution by agarose gel electrophoresis

Quality Control Measures:

  • Validation of IP Efficiency:

    • Perform Western blot analysis to confirm enrichment of Mb1846 in immunoprecipitated material

    • Use quantitative PCR to verify enrichment of positive control regions before sequencing

  • Sequencing Considerations:

    • Minimum of 20 million uniquely mapped reads per sample

    • Include biological replicates (minimum of two) to ensure reproducibility

  • Computational Analysis:

    • Use peak calling algorithms appropriate for transcription factors (e.g., MACS2)

    • Employ motif discovery tools (MEME, HOMER) to identify binding motifs

    • Integrate with RNA-seq data to correlate binding with gene expression changes

Validation Approaches:

  • Orthogonal Techniques:

    • Validate selected binding sites using ChIP-qPCR

    • Confirm direct binding using in vitro techniques like EMSAs or DNase I footprinting

  • Functional Validation:

    • Mutate identified binding sites and measure effects on gene expression

    • Perform reporter gene assays with wild-type and mutated binding sites

How should researchers interpret conflicting data about Mb1846's binding specificity and regulatory function?

When faced with conflicting data about Mb1846's binding specificity and regulatory function, researchers should implement a systematic approach to resolve discrepancies:

Sources of Conflict and Resolution Strategies:

  • Experimental Condition Variations:

    • Systematically test whether differences in pH, salt concentration, temperature, or cofactors affect Mb1846 binding specificity

    • Create a comprehensive matrix of conditions to identify parameters causing variability

  • Protein Oligomerization State:

    • Investigate whether Mb1846's binding specificity changes with its oligomerization state

    • Similar to other HTH-type regulators, Mb1846 may form tetramers when bound to DNA, which could affect its specificity

    • Use size exclusion chromatography or analytical ultracentrifugation to isolate different oligomeric forms for separate binding assays

  • Post-translational Modifications:

    • Examine whether Mb1846 undergoes post-translational modifications that alter its activity

    • Use mass spectrometry to identify potential modifications and create mutation constructs to mimic or prevent these modifications

  • Interaction Partners:

    • Test whether Mb1846 associates with different cofactors in various conditions

    • Perform co-immunoprecipitation experiments followed by mass spectrometry to identify interaction partners

    • Assess whether binding specificity changes in the presence of identified partners

Data Integration Framework:

Data TypeAnalysis ApproachWeight in Interpretation
In vivo binding (ChIP-seq)Identify consistent binding sites across conditionsHigh - represents physiological binding
In vitro binding (EMSA, SELEX)Determine core binding motif requirementsMedium - may miss contextual factors
Gene expression changesCorrelate with binding dataHigh - indicates functional relevance
Structural predictionsUse to interpret binding interfaceMedium - requires experimental validation
Evolutionary conservationAnalyze binding site conservationMedium - suggests functional importance

What computational approaches are recommended for predicting the regulatory network controlled by Mb1846?

Predicting the regulatory network of an uncharacterized transcriptional regulator like Mb1846 requires sophisticated computational approaches:

Network Prediction Methods:

  • Motif-Based Genome Scanning:

    • Once a binding motif is established through ChIP-seq or SELEX, scan the genome for potential binding sites

    • Use position weight matrices (PWMs) with appropriate statistical thresholds

    • Consider evolutionary conservation of predicted sites to prioritize functional binding sites

  • Integration with Chromatin Accessibility Data:

    • Overlay predicted binding sites with chromatin accessibility data (e.g., ATAC-seq or DNase-seq)

    • Sites in accessible regions are more likely to be functionally relevant

  • Gene Expression Correlation Analysis:

    • Analyze transcriptomic data under various conditions to identify genes with expression patterns correlating with Mb1846

    • Use clustering algorithms to group genes with similar expression profiles

  • Network Inference Algorithms:

    • Apply algorithms such as ARACNE, CLR, or GENIE3 to infer regulatory relationships from gene expression data

    • These methods can help identify direct and indirect regulatory connections

Validation and Refinement Approaches:

  • Experimental Validation:

    • Select representative predicted target genes for experimental validation

    • Use reporter assays or in vitro binding studies to confirm direct regulation

  • Network Comparison:

    • Compare predicted Mb1846 regulatory network with known networks of related transcriptional regulators

    • Identify shared and unique components that might suggest evolutionary relationships

  • Functional Enrichment Analysis:

    • Perform Gene Ontology or pathway enrichment analysis on predicted target genes

    • Enriched biological processes can suggest the functional role of Mb1846

  • Network Visualization:

    • Use tools like Cytoscape to visualize the predicted regulatory network

    • Incorporate different data types (binding strength, expression correlation) as visual elements

How can researchers determine if Mb1846 functions as a transcriptional activator, repressor, or dual regulator?

Determining the regulatory mode of Mb1846 requires a comprehensive experimental approach:

Experimental Methods for Functional Classification:

  • Gene Expression Analysis in Knockout/Overexpression Strains:

    • Create Mb1846 deletion mutants and strains overexpressing Mb1846

    • Perform RNA-seq under various conditions to identify genes with altered expression

    • Upregulation of genes in the absence of Mb1846 suggests repression, while downregulation suggests activation

  • Reporter Gene Assays:

    • Fuse promoters of potential target genes to reporter genes (e.g., lacZ, gfp)

    • Measure reporter activity in wild-type, Mb1846-deficient, and Mb1846-overexpressing backgrounds

    • Quantitative analysis can reveal activation, repression, or more complex regulatory patterns

  • In vitro Transcription Assays:

    • Use purified components (RNA polymerase, Mb1846, template DNA) to directly assess transcriptional effects

    • This approach can determine whether Mb1846 alone is sufficient for activation or repression

  • Analysis of RNA Polymerase Recruitment:

    • Perform ChIP-seq for RNA polymerase in presence and absence of Mb1846

    • Increased polymerase recruitment suggests activation, while decreased recruitment suggests repression

Dual Regulator Assessment:

Many HTH-type regulators function as dual regulators, activating some genes while repressing others depending on context . To assess this possibility:

  • Binding Position Analysis:

    • Map Mb1846 binding positions relative to transcription start sites

    • Different binding positions may correlate with different regulatory modes

  • Co-regulator Identification:

    • Identify proteins that interact with Mb1846 using pull-down assays coupled with mass spectrometry

    • Different interacting partners may influence whether Mb1846 functions as an activator or repressor

  • Condition-Dependent Analysis:

    • Test Mb1846 regulatory function under different growth conditions or stress responses

    • Some HTH-type regulators switch between activation and repression based on environmental conditions

What methods are most effective for studying the interaction of Mb1846 with the bacterial transcriptional machinery?

Investigating interactions between Mb1846 and the transcriptional machinery requires specialized techniques:

Protein-Protein Interaction Methods:

  • Bacterial Two-Hybrid System:

    • Adapt bacterial two-hybrid systems to test interactions between Mb1846 and components of the transcriptional machinery

    • Screen interactions with RNA polymerase subunits (α, β, β', σ) and other transcription factors

  • Co-Immunoprecipitation (Co-IP):

    • Perform Co-IP with tagged Mb1846 followed by Western blotting or mass spectrometry

    • Use crosslinking to capture transient interactions

  • Surface Plasmon Resonance (SPR):

    • Measure direct binding kinetics between Mb1846 and purified transcriptional machinery components

    • Determine association and dissociation rates under varying conditions

  • Protein-Protein FRET:

    • Use fluorescently labeled Mb1846 and RNA polymerase components to detect interactions in vitro or in vivo

    • This approach can provide spatial and temporal information about interactions

Transcription Complex Assembly Studies:

  • DNA-Protein Complex Analysis:

    • Use electrophoretic mobility shift assays (EMSAs) with increasing complexity of components

    • Start with Mb1846-DNA, then add RNA polymerase components sequentially to observe complex formation

  • Footprinting Techniques:

    • Apply DNase I or hydroxyl radical footprinting to map the protection patterns of DNA when bound by Mb1846 alone or in combination with RNA polymerase

    • Changes in protection patterns can reveal cooperative or competitive binding

  • Transcription Initiation Complex Analysis:

    • Use potassium permanganate footprinting to detect DNA melting associated with transcription initiation

    • Determine whether Mb1846 enhances or inhibits open complex formation

  • Single-Molecule Techniques:

    • Employ single-molecule FRET or optical tweezers to observe transcription complex assembly in real-time

    • These approaches can reveal transient intermediates in the assembly process

What are the key challenges and future research directions in characterizing uncharacterized HTH-type transcriptional regulators like Mb1846?

The characterization of uncharacterized HTH-type transcriptional regulators presents several significant challenges and opportunities for future research:

Current Challenges:

  • Functional Redundancy:

    • Many bacterial genomes contain multiple HTH-type regulators with potentially overlapping functions

    • Single gene knockout studies may show subtle phenotypes due to compensatory mechanisms

  • Context-Dependent Regulation:

    • HTH-type regulators often exhibit different behaviors depending on cellular context

    • The same regulator may act as an activator or repressor depending on binding position, interacting partners, or environmental conditions

  • Integration of Multiple Data Types:

    • Combining structural, genomic, transcriptomic, and biochemical data remains challenging

    • Computational frameworks for data integration need further development

Future Research Directions:

  • Systems Biology Approaches:

    • Apply network analysis to understand how Mb1846 functions within the broader transcriptional regulatory network

    • Use mathematical modeling to predict regulatory outcomes under various conditions

  • Single-Cell Technologies:

    • Implement single-cell RNA-seq to capture cell-to-cell variability in Mb1846-mediated regulation

    • This approach can reveal stochastic effects and population heterogeneity

  • Structural Dynamics:

    • Study the conformational changes of Mb1846 upon DNA binding using hydrogen-deuterium exchange mass spectrometry or FRET

    • Understand how structural dynamics influence regulatory function

  • Synthetic Biology Applications:

    • Engineer Mb1846 variants with altered specificity or function

    • Explore potential applications in synthetic gene circuits or biosensors

  • Evolution and Adaptation:

    • Investigate how Mb1846 and related regulators evolve in response to environmental changes

    • Study horizontal gene transfer and its impact on regulatory network evolution

By addressing these challenges and pursuing these research directions, scientists can develop a more comprehensive understanding of how uncharacterized HTH-type transcriptional regulators like Mb1846 contribute to bacterial gene regulation and adaptation to environmental changes.

How can findings about Mb1846 contribute to our broader understanding of bacterial transcriptional regulation?

Research on uncharacterized regulators like Mb1846 has significant potential to expand our understanding of bacterial transcriptional regulation in several ways:

  • Discovery of Novel Regulatory Mechanisms:

    • Characterization of Mb1846 may reveal previously unknown mechanisms of transcriptional control

    • The regulatory principles discovered could be applicable to other bacterial species

  • Network Architecture Understanding:

    • Mapping Mb1846's regulatory network can provide insights into how bacterial regulatory networks are organized

    • This contributes to our understanding of regulatory network evolution and adaptation

  • Stress Response and Adaptation:

    • If Mb1846 is involved in stress responses, its characterization could reveal how bacteria sense and adapt to environmental changes

    • This knowledge is crucial for understanding bacterial survival in changing environments

  • Cross-Talk Between Regulatory Systems:

    • Studying Mb1846 may reveal interactions with other regulatory systems like two-component systems or small RNA regulators

    • Such cross-talk is fundamental to integrated cellular responses

  • Functional Annotation Improvement:

    • Detailed characterization of Mb1846 will improve functional annotation of related proteins across bacterial species

    • This advances our ability to predict gene function from sequence data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.