Recombinant Uncharacterized membrane protein F35D11.3 (F35D11.3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
F35D11.3; Uncharacterized membrane protein F35D11.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-617
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F35D11.3
Target Protein Sequence
MSKCATPTPSTSSNSSDEAKRSPQPMSRGFPQRNMSTTSSNGSNSPRHRSLETPIVLQPA TRFALANLTTTVLRLDFWDDNDPNSIFFCKSTFNIVTQCLDLPEKVIKTVKTHLEGEEDL TDIAPMIMSVREDPVYKTEGSTPFLASLLVAFVNQGNYDSRYRVFLRHLTTLLGVVWTEF EDVEDSLASTLLEEQFVESEHSRTVREKTARNKKIKRYLMIGAAGGVGGVLIGLTGGLAA PLVAASAGMLIGGGAVAGLATTAGAAVLGTTMGVAGAGFTGYKMKKRVGAIEEFSVETLS EGVSLSCSLVVSGWIESDTSPDQAFVHQWRHLRHTKEQYTLRYESNYLMELGNAIEYLMS FAVSVAIQQTLLETALAGLVSAVAWPVALMSVSSVLDNPWNVCVSRAAEVGEQLAEVLLS RSHGKRPITLIGFSLGARVIFHCLLTMSKRSESVGIIEDVILLGAPVTASPKEWSKVCTV VSGRVINGYCETDWLLRFLYRTMSAQFRIAGTGPIDNRNSKKIYNYNLSHIVKGHMDYSK RLTEVLNAVGVKVGPHSEDSVVDLTQLEGPHEATGQAEEAINYQSTGEEEEHPIVHPINL ENIHEVKVLDSPHKNEF
Uniprot No.

Target Background

Database Links
Protein Families
TMCO4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the basic structure of F35D11.3?

F35D11.3 is a full-length (617 amino acids) uncharacterized membrane protein found in Caenorhabditis elegans. The protein has a UniProt accession number of Q20035 and contains multiple hydrophobic regions consistent with its classification as a membrane protein . The amino acid sequence indicates several potential transmembrane domains, with glycine-rich regions that may be important for membrane integration or protein-protein interactions . When working with this protein, researchers should note that its full sequence contains multiple hydrophobic stretches that may influence solubility during purification procedures.

How is recombinant F35D11.3 typically produced for research purposes?

Recombinant F35D11.3 is commonly produced in E. coli expression systems with affinity tags (such as His-tags) to facilitate purification . The production process typically involves:

  • Cloning the F35D11.3 coding sequence into a bacterial expression vector

  • Transforming the construct into an E. coli strain optimized for membrane protein expression

  • Inducing expression under controlled temperature and media conditions

  • Lysing cells and solubilizing membrane fractions with appropriate detergents

  • Purifying the protein using affinity chromatography based on the attached tag

For optimal results, expression conditions should be carefully optimized as membrane proteins often present folding challenges in bacterial systems.

What are the key challenges in studying uncharacterized membrane proteins like F35D11.3?

Studying uncharacterized membrane proteins presents several methodological challenges:

  • Protein solubility: Membrane proteins are hydrophobic and often aggregate during purification. For F35D11.3, researchers should test multiple detergents (DDM, CHAPS, Triton X-100) at various concentrations to identify optimal solubilization conditions.

  • Functional assays: Without known functions, researchers must employ multiple approaches:

    • Protein interaction studies (pull-downs, co-immunoprecipitation)

    • Localization studies in C. elegans using fluorescent tags

    • Phenotypic analysis of knockout/knockdown worms

    • Bioinformatic prediction of function based on sequence motifs

  • Structural characterization: Membrane proteins are challenging for structural studies. Consider detergent screening, lipid nanodiscs, or amphipols to maintain native conformation for techniques like cryo-EM.

How should researchers approach functional characterization of F35D11.3?

When characterizing an uncharacterized protein like F35D11.3, a systematic multi-pronged approach is recommended:

  • Genetic analysis: Create knockout/knockdown models in C. elegans using CRISPR-Cas9 or RNAi techniques to observe phenotypic effects

  • Expression pattern analysis: Generate transgenic worms expressing F35D11.3::GFP fusion to determine tissue-specific expression patterns

  • Interactome mapping: Perform immunoprecipitation coupled with mass spectrometry to identify binding partners, which may provide functional clues

  • Comparative genomics: Analyze potential homologs in other organisms to identify conserved domains or functions

  • Transcriptional profiling: Analyze gene expression changes in F35D11.3 mutants to identify pathways affected by the protein

This systematic approach allows researchers to gradually build evidence for potential functions, even without prior knowledge of the protein's role.

How might F35D11.3 potentially relate to longevity pathways in C. elegans?

While direct evidence linking F35D11.3 to longevity pathways is not established in the provided research, several considerations merit investigation:

C. elegans aging research has identified several key pathways, including the insulin/IGF-1 signaling pathway regulated by DAF-16/FOXO transcription factors. HCF-1 has been identified as a negative regulator of DAF-16, with HCF-1 inactivation extending lifespan by up to 40% . Researchers investigating potential connections between F35D11.3 and longevity should:

  • Perform lifespan assays in F35D11.3 mutant worms

  • Conduct epistasis analysis with known longevity genes (daf-2, daf-16, hcf-1)

  • Analyze expression of F35D11.3 under conditions that extend lifespan (dietary restriction, reduced insulin signaling)

  • Investigate potential physical interactions between F35D11.3 and known longevity regulators

Methodologically, these experiments require careful standardization of environmental conditions and statistical analysis of survival curves with appropriate sample sizes.

What experimental approaches are recommended for determining the subcellular localization of F35D11.3?

Determining subcellular localization of membrane proteins requires multiple complementary approaches:

  • Fluorescent protein fusion: Create N- and C-terminal GFP fusions of F35D11.3 and express in C. elegans to visualize localization patterns in vivo. Important controls include:

    • Verification that the fusion protein retains functionality

    • Comparison of N- vs C-terminal tags to ensure targeting signals aren't masked

    • Co-localization with established organelle markers

  • Subcellular fractionation: Isolate different membrane compartments from C. elegans and perform Western blotting to detect native F35D11.3

  • Immunogold electron microscopy: For high-resolution localization, develop specific antibodies against F35D11.3 and use immunogold labeling

  • Proximity labeling: Express F35D11.3 fused to promiscuous biotin ligases (BioID or TurboID) to identify proximal proteins that could indicate the compartment where F35D11.3 resides

Combining these approaches provides robust evidence for subcellular localization while mitigating the limitations of any single method.

How should researchers interpret contradictory data when studying uncharacterized proteins like F35D11.3?

When studying uncharacterized proteins like F35D11.3, contradictory results are common and require careful interpretation:

  • Methodological analysis: Evaluate whether differences stem from experimental approaches:

    • Different expression systems (bacterial vs. insect vs. mammalian)

    • Varied solubilization conditions affecting protein conformation

    • Tag interference with protein function

  • Biological complexity assessment:

    • Consider that F35D11.3 may have multiple functions in different contexts

    • Evaluate developmental stage-specific or tissue-specific effects

    • Assess potential redundancy with other membrane proteins

  • Technical validation strategy:

    • Implement multiple technical approaches to confirm findings

    • Use complementary genetic and biochemical methods

    • Perform rescue experiments with the wild-type protein to confirm specificity

  • Statistical robustness:

    • Ensure adequate biological and technical replicates

    • Use appropriate statistical tests for the data type

    • Consider Bayesian approaches to integrate multiple data types

Remember that seemingly contradictory results often lead to new discoveries about protein multifunctionality or context-dependent activities.

What bioinformatic approaches are most valuable for predicting functions of F35D11.3?

For uncharacterized proteins like F35D11.3, bioinformatic approaches provide crucial insights:

  • Structural prediction:

    • Use AlphaFold2 or RoseTTAFold to predict 3D structure

    • Apply TMHMM or TOPCONS for transmembrane domain prediction

    • Identify structural domains using InterProScan or Pfam

  • Functional prediction:

    • Perform Position-Specific Iterative BLAST (PSI-BLAST) to find distant homologs

    • Use Gene Ontology term enrichment among similar proteins

    • Apply machine learning approaches trained on protein features

  • Network analysis:

    • Identify potential protein-protein interactions through databases and prediction algorithms

    • Map F35D11.3 to known interaction networks in C. elegans

    • Use guilt-by-association approaches based on co-expression data

  • Evolutionary analysis:

    • Calculate conservation scores across nematodes and other phyla

    • Identify functionally important residues through evolutionary rate analysis

    • Perform synteny analysis to identify conserved genomic context

These computational approaches generate testable hypotheses that guide subsequent experimental work.

What are the optimal conditions for expressing and purifying recombinant F35D11.3?

Optimizing expression and purification of membrane proteins like F35D11.3 requires careful consideration:

  • Expression system selection:

    • E. coli: BL21(DE3) or C41/C43 strains specifically designed for membrane proteins

    • Consider insect cells (Sf9 or Hi5) for improved folding

    • Evaluate yeast expression systems for eukaryotic processing

  • Expression optimization:

    • Test induction at lower temperatures (16-20°C)

    • Consider autoinduction media to avoid toxicity

    • Evaluate expression with different promoters (T7, tac, araBAD)

  • Solubilization approach:

    • Screen detergent panel (DDM, LMNG, GDN, CHAPS)

    • Test mixed micelle systems with cholesterol hemisuccinate

    • Consider styrene maleic acid lipid particles (SMALPs) for native lipid retention

  • Purification strategy:

    • Implement two-step purification (affinity followed by size exclusion)

    • Include stabilizing agents throughout purification (glycerol, specific lipids)

    • Maintain cold temperature to prevent aggregation

  • Quality control:

    • Verify homogeneity by dynamic light scattering

    • Confirm structural integrity by circular dichroism

    • Assess functionality through binding assays if possible

Optimization should be empirical, with systematic testing of multiple conditions to identify the most suitable protocol.

How can researchers develop specific antibodies against F35D11.3?

Developing specific antibodies against membrane proteins presents unique challenges:

  • Antigen design options:

    • Recombinant full-length protein in detergent micelles

    • Synthetic peptides from predicted extracellular loops

    • Fusion proteins containing hydrophilic domains

  • Immunization strategy:

    • Use multiple rabbits or mice to increase success probability

    • Implement longer immunization schedules for membrane proteins

    • Consider DNA immunization with F35D11.3 expression vectors

  • Screening methodology:

    • ELISA against recombinant protein and peptide antigens

    • Western blotting against native and recombinant protein

    • Immunofluorescence in transfected cells and C. elegans tissues

    • Test on F35D11.3 knockout samples as negative controls

  • Antibody validation:

    • Test specificity using knockout/knockdown samples

    • Verify by immunoprecipitation followed by mass spectrometry

    • Characterize epitope using peptide arrays or mutagenesis

Researchers should be prepared for multiple rounds of screening and validation to obtain truly specific antibodies.

How can researchers determine if F35D11.3 might be involved in longevity pathways similar to HCF-1?

To investigate potential roles of F35D11.3 in longevity regulation similar to HCF-1:

  • Lifespan analysis:

    • Measure lifespan in F35D11.3 knockout/knockdown worms

    • Test interactions with known longevity pathways through double mutants (with daf-2, daf-16, hcf-1)

    • Analyze lifespan under various stress conditions (oxidative, heat, UV)

  • Molecular pathway analysis:

    • Determine if F35D11.3 physically interacts with DAF-16 or HCF-1 using co-immunoprecipitation

    • Perform ChIP-seq to identify if F35D11.3 associates with chromatin or transcription factors

    • Analyze transcriptional changes in F35D11.3 mutants, focusing on DAF-16 target genes

  • Biochemical assays:

    • Test if F35D11.3 affects DAF-16 nuclear localization using fluorescent reporters

    • Investigate post-translational modifications of longevity-related proteins in F35D11.3 mutants

    • Determine if F35D11.3 affects DAF-16 binding to target promoters

Given that HCF-1 functions as a negative regulator of DAF-16 and extends lifespan by up to 40% when inactivated , researchers should specifically examine whether F35D11.3 has similar regulatory effects on DAF-16 activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.