Recombinant Uncharacterized membrane protein ML0467 (ML0467)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please specify your preference when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ML0467; B1177_C2_172/B1177_C1_140; MLCL581.27; Uncharacterized membrane protein ML0467
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML0467
Target Protein Sequence
MDVDALLQSIPPLAVYLLVSGVVGVESLGIPLPGEVVLVSAALLSSRHDLAVSSIGVGVV AVIGAAVGDSIGYAIGRRFGMPLFDHLGRRFPKHFGPGHVALVERLFNRWGVRAVFFGRF IALLRILAGPLAGALKMHYPRFLAANVSGAICWAGGTTALVYFAGMAAERWMERFSWIAL IITVVVGIIAAILLRERTSRIIAELEMEYKNRRH
Uniprot No.

Target Background

Database Links

KEGG: mle:ML0467

STRING: 272631.ML0467

Protein Families
DedA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should ML0467 recombinant protein be stored and reconstituted?

For optimal stability, store ML0467 protein at -20°C/-80°C upon receipt. Aliquoting is necessary to avoid repeated freeze-thaw cycles as this can significantly compromise protein integrity . The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended for long-term storage)

  • Store working aliquots at 4°C for up to one week

What expression systems are commonly used for ML0467 production?

The primary expression system documented for ML0467 is E. coli . While mammalian or insect cell expression systems might theoretically provide better folding for membrane proteins, published data specifically for ML0467 focuses on bacterial expression. When working with this protein, researchers should consider:

Expression SystemAdvantagesDisadvantagesRecommended for ML0467
E. coliHigh yield, cost-effective, rapid growthMay not provide proper folding for all membrane proteinsYes (documented success)
Mammalian cellsBetter folding of complex proteins, post-translational modificationsHigher cost, longer production timeNot extensively documented
Insect cellsBetter folding than E. coli, high yieldMore complex than bacterial systemsNot extensively documented
Cell-free systemsAvoids toxicity issuesHigher cost, specialized equipmentPotential alternative for further study

What are the critical considerations when designing experiments with ML0467?

When designing experiments with ML0467, researchers should address several critical factors to ensure reliability and reproducibility:

  • Protein Stability Assessment: Before functional assays, verify protein stability through size-exclusion chromatography or dynamic light scattering

  • Membrane Environment: As a membrane protein, ML0467 requires proper reconstitution in a membrane mimetic environment for functional studies

  • Control Experiments: Include both positive controls (well-characterized membrane proteins) and negative controls (buffer-only conditions)

  • Replicability Planning: Design experiments with sufficient biological and technical replicates (minimum n=3) to enable statistical validation

  • Environmental Variables Control: Carefully control temperature, pH, and salt concentration as these significantly affect membrane protein behavior

The optimization of experimental parameters is essential for improving data quality and obtaining reproducible results, as demonstrated in studies with other membrane proteins and cell-based assays .

How should data tables be constructed for ML0467 experimental results?

When constructing data tables for ML0467 experiments, follow these guidelines to ensure clarity and reproducibility:

  • Create a clear title that states the purpose of the experiment (e.g., "The effect of detergent concentration on ML0467 stability")

  • Place the independent variable (what you purposefully change) in the left column

  • Place the dependent variable (what you measure) with different trials in subsequent columns

  • Include a derived or calculated column (often average) on the far right

  • Clearly label all units of measurement

  • Use consistent formatting and avoid unnecessary decorative elements

Example data table format:

Detergent Concentration (%)Activity Trial 1 (units)Activity Trial 2 (units)Activity Trial 3 (units)Average Activity (units)
0.01[data][data][data][calculated]
0.05[data][data][data][calculated]
0.10[data][data][data][calculated]
0.50[data][data][data][calculated]

What methodologies are recommended for studying ML0467 interaction with other proteins?

For studying protein-protein interactions involving ML0467, consider these methodological approaches:

  • Co-Immunoprecipitation: Use anti-His antibodies to pull down ML0467 and identify binding partners through mass spectrometry

  • Biolayer Interferometry (BLI): Immobilize His-tagged ML0467 on Ni-NTA biosensors to measure binding kinetics with potential partners

  • Microscale Thermophoresis (MST): Examine interactions in solution with minimal protein consumption

  • Crosslinking Mass Spectrometry: Identify proximity relationships between ML0467 and other proteins

  • Yeast Two-Hybrid: Consider membrane-based Y2H systems specifically designed for membrane proteins

For membrane proteins like ML0467, it's crucial to maintain the protein in a membrane-like environment during interaction studies, possibly using nanodiscs or detergent micelles that preserve native conformation .

How should researchers approach contradictory data when working with ML0467?

When facing contradictory data with ML0467 experiments, follow this systematic approach:

  • Verify Protein Quality: Reassess protein purity, concentration, and structural integrity using methods like SDS-PAGE and circular dichroism

  • Examine Experimental Conditions: Check for variations in buffer composition, pH, temperature, and detergent concentration between experiments

  • Statistical Validation: Apply appropriate statistical tests to determine if differences are statistically significant

  • Consider Biological Variables: Evaluate whether differences in expression systems or membrane environments might explain variability

  • Secondary Data Analysis: Review existing literature on similar membrane proteins to identify possible explanations for contradictory results

It's worth noting that differences of up to 200-fold in experimental values have been observed in large-scale dose-response studies performed by different research teams, highlighting the importance of standardized protocols .

What statistical approaches are most appropriate for analyzing ML0467 functional data?

When analyzing functional data for ML0467, consider these statistical approaches:

  • Descriptive Statistics: Calculate means, standard deviations, and coefficient of variation for all measurements

  • Normality Testing: Apply Shapiro-Wilk or Kolmogorov-Smirnov tests to determine if data follows normal distribution

  • Parametric Tests: Use t-tests for comparing two conditions or ANOVA for multiple conditions if data is normally distributed

  • Non-Parametric Alternatives: Apply Mann-Whitney U or Kruskal-Wallis tests if normality assumptions are violated

  • Regression Analysis: For dose-response experiments, use non-linear regression to calculate EC50/IC50 values

  • Replicability Assessment: Calculate intra-class correlation coefficients to quantify reproducibility between experiments

For membrane proteins like ML0467, variability tends to be higher than for soluble proteins, so robust statistical approaches with sufficient replicates are essential.

How can researchers restore full biological activity to the isolated ectodomain of ML0467?

The activity of membrane proteins often depends on their association with lipid bilayers. For ML0467, consider these approaches to restore full activity to the isolated ectodomain:

  • Metal-Chelating Lipid Strategy: If using His-tagged ML0467 (ML0467-His), incorporate nickel-chelating lipids (like Ni-NTA-DOGS) into liposomes to anchor the protein to the membrane surface via the His-tag

  • Nanodisc Reconstitution: Incorporate ML0467 into nanodiscs composed of phospholipids and membrane scaffold proteins to provide a native-like bilayer environment

  • GPI-Anchoring: Engineer a GPI-anchoring signal to the C-terminus of ML0467 ectodomain to facilitate membrane attachment

  • Transmembrane Domain Addition: Create chimeric constructs with well-characterized transmembrane domains if the native transmembrane regions are problematic

Studies with other membrane proteins have shown that anchoring the ectodomain to membranes can restore binding affinity comparable to the full-length membrane-spanning protein .

What approaches can be used for secondary analysis of existing ML0467 data?

Secondary data analysis (SDA) of existing ML0467 data can provide valuable insights:

  • Meta-Analysis: Combine results from multiple independent studies to increase statistical power

  • Comparative Analysis: Compare ML0467 data with similar proteins from related Mycobacterium species

  • Structural Prediction Validation: Use experimental data to validate or refine computational structure predictions

  • Pathway Integration: Incorporate ML0467 functional data into broader mycobacterial membrane transport pathways

  • Cross-Study Standardization: Normalize data across studies using reference standards to enable meaningful comparison

When conducting SDA, be aware of limitations such as the primary dataset not fitting the secondary analysis exactly and the inability to definitively examine causality given the retrospective nature of the analysis .

How can researchers improve replicability and reproducibility in ML0467 studies?

To enhance replicability and reproducibility in ML0467 studies:

  • Standardized Protocols: Develop and share detailed protocols including buffer compositions, incubation times, and temperature controls

  • Reagent Validation: Verify protein quality metrics before experiments and use consistent sources for critical reagents

  • Experimental Design Optimization: Identify and control for cell line-specific, protein-specific, and context-dependent variables

  • Blind Analysis: When possible, have data analyzed by researchers unaware of experimental conditions

  • Complete Data Reporting: Report all experimental attempts, including unsuccessful ones, to avoid publication bias

  • Cross-Laboratory Validation: Collaborate with other laboratories to verify key findings using identical protocols and reagents

Studies have shown that factors affecting reproducibility often vary in magnitude depending on the specific experimental context, emphasizing the need for protein-specific optimization .

What are the common challenges in purifying ML0467 and how can they be addressed?

Membrane protein purification presents several challenges that are relevant to ML0467:

ChallengeSolutionRationale
Low expression levelsOptimize codon usage for E. coli; consider fusion tags like MBPImproves translation efficiency and protein folding
Protein aggregationScreen different detergents (DDM, LMNG, CHAPS)Different detergents have varying abilities to solubilize membrane proteins
ImpuritiesImplement two-step purification (IMAC followed by size exclusion)Removes non-specific binders and aggregates
Loss of activityAdd lipids during purification; minimize time in detergentStabilizes native conformation
Batch-to-batch variabilityStandardize growth conditions (OD at induction, temperature, time)Ensures consistent protein production

Preliminary screening of multiple conditions in small-scale is recommended before scaling up to optimize purification yield and quality.

How can researchers address negative effects of evaporation and DMSO solvent in ML0467 activity assays?

Cell viability and protein activity assays can be negatively affected by evaporation and DMSO solvent effects . To address these issues:

  • Edge Effect Mitigation: Use only interior wells of plates for critical samples or fill outer wells with buffer

  • Humidity Control: Maintain consistent humidity during incubations, possibly using humidified chambers

  • DMSO Concentration: Keep DMSO concentration below 0.5% in final assay conditions

  • Consistent Controls: Include vehicle controls with identical DMSO concentrations

  • Plate Sealing: Use breathable seals that minimize evaporation while allowing gas exchange

  • Temperature Equilibration: Allow plates to reach room temperature before removing seals to prevent condensation

Experimental design should include controls that specifically account for these variables to distinguish true biological effects from technical artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.