Recombinant Uncharacterized membrane protein OtCpg00060 (OtCpg00060)

Shipped with Ice Packs
In Stock

Description

Introduction to OtCpg00060

The Uncharacterized membrane protein OtCpg00060 (also known as ORF537) is a protein encoded by the OtCpg00060 gene in Ostreococcus tauri, one of the smallest known free-living eukaryotes and an ancient organism of the green algal lineage . Initially classified as an uncharacterized membrane protein, recent research has identified this protein as a Type III Glutamine Synthetase (GSIII) . Glutamine synthetases are critical enzymes that catalyze the synthesis of glutamine from glutamate and ammonium, playing vital roles in various metabolic processes including protein biosynthesis, purine biosynthesis, lipid biosynthesis, and nitrogen transport and storage .

What makes OtCpg00060 particularly interesting is its unique structural arrangement compared to other glutamine synthetases. While most glutamine synthetases in other classes form double-stacked ring assemblies, OtCpg00060 has been demonstrated to self-assemble and function exclusively as a single hexameric ring . This structural distinction suggests potential evolutionary adaptations in this ancient organism and offers insights into the diversity of glutamine synthetase structures across different species.

Oligomeric Structure

One of the most significant findings regarding OtCpg00060 is its unique oligomeric assembly. Research has demonstrated that unlike most glutamine synthetases that form dodecameric two-ring structures with 6-fold dihedral symmetry, OtCpg00060 exists exclusively as a defined and stable hexamer with an approximate molecular weight of 463 kDa .

This hexameric structure has been confirmed through multiple analytical techniques:

  1. Native PAGE analysis showing a single well-defined complex with an approximate molecular weight of 500-550 kDa

  2. Native mass spectrometry precisely measuring the complex at 463.4 kDa, corresponding to a hexamer of OtCpg00060

  3. Cryo-electron microscopy (cryo-EM) visualizing the single stacked hexameric "pinwheel" morphology

The stability of this hexameric structure is remarkable, as it did not dissociate or release monomers even at maximum collision energy during mass spectrometry analysis, indicating exceptionally strong inter-subunit interfaces .

Cryo-EM Structure

The cryo-EM structure of OtCpg00060, resolved to 3.18Å resolution, revealed several important structural features:

  1. The complex exhibits C6 symmetry, confirming its hexameric nature

  2. The catalytic core and many secondary and tertiary elements at the monomer level are well-conserved compared to other glutamine synthetase family proteins

  3. Key variations between glutamine synthetase classes were observed in quaternary interactions, particularly in both intra-ring and inter-ring contacts

  4. Intra-ring interactions are weakened in the center of the ring for the O. tauri hexamer, but include beta-hairpins, which represent new peripheral quaternary structures

This represents the first structure of a eukaryotic type III glutamine synthetase, providing valuable insights into the structural evolution of this important enzyme family .

Enzymatic Activity

As a glutamine synthetase, OtCpg00060 catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine, playing a critical role in nitrogen metabolism . Functional studies have confirmed that the hexameric form of OtCpg00060 is enzymatically active, demonstrating that the double-ring structure observed in other glutamine synthetases is not necessarily required for catalytic activity .

The activity of OtCpg00060 has been validated through inhibition studies using phosphinothricin (PPT), a known herbicide that irreversibly inhibits glutamine synthetases . Experiments showed that:

  1. OtCpg00060 activity was dramatically affected by PPT exposure

  2. A 50% reduction in activity was observed at 0.4 mM PPT

  3. Only 20% of activity remained at 2 mM PPT concentration

These findings confirm that despite its unique oligomeric structure, OtCpg00060 functions as a bona fide glutamine synthetase with enzymatic properties consistent with this enzyme family.

Evolutionary Significance

The discovery that O. tauri GSIII functions exclusively as a hexamer rather than the dodecameric structure typical of prokaryotic GSIIIs suggests significant evolutionary adaptations . This structural difference indicates that evolutionary pressure may have favored higher-order interactions in some organisms, while the basic hexameric structure remained sufficient for catalytic performance in O. tauri .

The genome of O. tauri is highly compressed with only approximately 8,000 genes, and it contains only a single gene with homology to glutamine synthetase . This genomic economy and the unique structural features of OtCpg00060 provide insights into the minimal requirements for glutamine synthetase function and the evolutionary diversity of this enzyme family across different domains of life.

Recombinant Production

For research applications, recombinant OtCpg00060 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . Both long and short versions of the GSIII gene have been amplified from O. tauri genomic DNA, with proteomic evidence suggesting that the shorter version is predominant in native expression .

Cell-free expression systems using wheat germ have also been successfully employed for producing functional OtCpg00060 protein for structural studies . This approach allows for rapid production of the protein for biochemical and structural characterization.

Enzymatic and Functional Studies

The unique hexameric structure of OtCpg00060 makes it an excellent model for studying the minimal functional requirements of glutamine synthetases . Researchers can investigate how quaternary structure influences catalytic activity and substrate specificity, particularly since the catalytic site is positioned alongside quaternary interfaces that impact drug/inhibitor binding .

Herbicide Resistance Studies

Given its sensitivity to the herbicide phosphinothricin (PPT), OtCpg00060 can serve as a model for studying herbicide resistance mechanisms and developing new agricultural technologies . Understanding the structural basis for herbicide binding and inhibition could potentially lead to the development of more effective or selective herbicides.

Future Research Directions

While significant progress has been made in characterizing OtCpg00060, several areas warrant further investigation:

  1. Detailed analysis of the catalytic mechanism specific to the hexameric structure

  2. Comparative studies with other eukaryotic type III glutamine synthetases to better understand evolutionary relationships

  3. Investigation of potential regulatory mechanisms controlling OtCpg00060 activity in O. tauri

  4. Exploration of the membrane association properties suggested by its classification as a membrane protein

Such studies would further enhance our understanding of this unique protein and its role in the biology of O. tauri and potentially inform broader applications in biotechnology and agriculture.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OtCpg00060; Uncharacterized membrane protein OtCpg00060; ORF537
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-537
Protein Length
full length protein
Species
Ostreococcus tauri
Target Names
OtCpg00060
Target Protein Sequence
MENSIGLGLIHGLMYGIVPVAPWFVALKRYLLEGKEKGQLAVAGTIAGQVTLLALTFFGW SRVLWVWYYFEPALIILGTMAVVRCALDCWVEQESSLRTAALGPGAGQLASKQEGLYYFL MSFGLMFCNPLHLEGSQTLLSSIPGNRYVYLLAFTVSYTAIIFIFWVTLGYRIFGKAYSG FGAQQTLNRYRIRRVSVGIVAALFLQFANCTPEALVIYHWDSLLAYTPFDGLKHHRTRGY TWEPSSDNAFELSRQSYRATNRAGVSFEQGAKRAVQFKPFWNTETRFDECNQVRERELSN EDWNAEATFHEFQGINQGVLRARSVPFNLYMVPNWEKQEDKNYLLTLRQIRDEMDDKLMA ESSPQERFLVSPFTDNLDYEVDYQVYPELMAEKAQTKTAYADMVKLIRGTKWTSNHVHLG DGTDVEMSYAKLHALPAEVRLPWHYPVVKPTEVVVQTSSTDTPDSVQLLNDELQENLHFF SNEPERIQQNVYKRLWEHRTFGKVTPRMIDDKVQKRLDDRVNMRREAYVSSNPTKAK
Uniprot No.

Target Background

Database Links

KEGG: ota:OstapCp06

STRING: 70448.Q0P3P6

Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is OtCpg00060 protein and what organism does it originate from?

OtCpg00060 is an uncharacterized membrane protein consisting of 537 amino acids originating from Ostreococcus tauri, a marine picoeukaryote. This protein (UniProt ID: Q0P3P6) is also known by its synonyms OtCpg00060 and ORF537. The protein is believed to play a role in viral immunity pathways, making it a significant subject for research in marine molecular biology and host-pathogen interactions .

How is recombinant OtCpg00060 protein typically produced for research?

Recombinant full-length OtCpg00060 protein is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. The procedure involves cloning the full coding sequence (amino acids 1-537) into appropriate expression vectors, transforming E. coli cells, inducing protein expression, and purifying using affinity chromatography. The purified protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis .

What are the recommended storage conditions for recombinant OtCpg00060 protein?

For optimal stability of recombinant OtCpg00060 protein, researchers should store the lyophilized powder at -20°C/-80°C upon receipt. Proper aliquoting is necessary for multiple use to minimize freeze-thaw cycles, which should be avoided. For working solutions, reconstituted protein can be stored as working aliquots at 4°C for up to one week. The recommended reconstitution protocol involves using deionized sterile water to a concentration of 0.1-1.0 mg/mL with the addition of 5-50% glycerol (final concentration) for long-term storage, with 50% being the standard recommendation .

What is the optimal protocol for reconstituting lyophilized OtCpg00060 protein?

The optimal reconstitution protocol for lyophilized OtCpg00060 protein involves first briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. The protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. For long-term storage stability, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation). After reconstitution, the solution should be gently mixed until completely dissolved, avoiding vigorous shaking which may cause protein denaturation. The reconstituted protein should then be aliquoted to minimize freeze-thaw cycles and stored at -20°C/-80°C for long-term use or at 4°C for up to one week for immediate applications .

How can researchers verify the purity and integrity of recombinant OtCpg00060 protein?

Researchers can verify the purity and integrity of recombinant OtCpg00060 protein through multiple complementary techniques. SDS-PAGE analysis is the primary method to assess purity, with quality recombinant preparations typically showing greater than 90% purity. Western blotting using anti-His tag antibodies can confirm the presence of the full-length protein. Additional verification methods include mass spectrometry for accurate molecular weight determination and N-terminal sequencing to confirm protein identity. For functional integrity assessment, researchers should consider membrane protein-specific assays such as circular dichroism to evaluate secondary structure content or detergent solubility tests to confirm proper folding of this membrane protein. For applications requiring higher purity, additional chromatography steps such as size exclusion or ion exchange can be implemented .

What experimental systems are suitable for studying OtCpg00060 function?

Several experimental systems can be employed to study OtCpg00060 function, each with specific advantages:

Experimental SystemAdvantagesKey Applications
Ostreococcus tauri culturesNative cellular environmentViral immunity studies, natural function assessment
E. coli membrane fractionsHigh expression levelsProtein-protein interaction studies, topology analysis
Liposome reconstitutionControlled membrane environmentTransport studies, structural analysis
Heterologous expression in yeastEukaryotic processingPost-translational modification studies
OtV5 viral challenge assaysFunctional relevanceImmunity pathway elucidation

When studying viral immunity functions, researchers typically culture O. tauri cells and challenge them with OtV5 virus to assess susceptibility or resistance. This can be combined with genetic manipulation of the OtCpg00060 gene to determine its specific role in viral resistance pathways .

How is OtCpg00060 involved in viral resistance in Ostreococcus tauri?

OtCpg00060 appears to play a significant role in the viral immunity pathways of Ostreococcus tauri, particularly in resistance to the OtV5 virus. Research suggests this membrane protein may be involved in either preventing viral entry, restricting viral replication, or participating in cellular defense signaling. Experimental studies have demonstrated that O. tauri clonal lines can be categorized as either susceptible or resistant to OtV5 infection, with differential expression of OtCpg00060 observed between these phenotypes. Specifically, resistant lines show altered expression patterns of this protein compared to susceptible controls, indicating its potential involvement in the resistance mechanism. The protein may function as a receptor or receptor-associated component that undergoes modification to prevent viral recognition, or it could participate in downstream signaling cascades that activate cellular defense mechanisms .

What experimental strategies are used to study OtCpg00060 in the context of viral immunity?

Researchers employ several specialized experimental strategies to investigate OtCpg00060's role in viral immunity:

  • Clonal selection approach: Starting with a single colony of O. tauri to produce independent clonal lines that are either susceptible or resistant to OtV5 virus.

  • Viral challenge assays: Exposing cultures to clonal OtV5 virus and monitoring for cell lysis or resistance.

  • Transcriptome analysis: Sequencing the transcriptomes of resistant and susceptible lines to identify differential expression patterns of OtCpg00060 and related genes.

  • Resistance phenotype characterization: Classifying resistant lines into subcategories such as resistant producer (RP) and resistant non-producer (RNP) based on their ability to produce viruses.

  • Long-term stability assessment: Monitoring the proportion of RP and RNP lines over time to understand the stability of the resistance phenotype.

This multi-faceted approach allows researchers to correlate OtCpg00060 expression and function with viral resistance phenotypes, providing insights into the underlying mechanisms of immunity in this marine picoeukaryote .

What is the relationship between OtCpg00060 expression and viral resistance phenotypes?

Differential gene expression analysis reveals that OtCpg00060 expression levels vary significantly between OtV5-resistant and susceptible O. tauri lines. In viral resistance studies, researchers have observed two distinct phenotypes among resistant lines: resistant producer (RP) and resistant non-producer (RNP). The proportion of these phenotypes changes over time, suggesting dynamic regulation of the resistance mechanisms. Transcriptome sequencing data indicates that OtCpg00060 expression is upregulated in resistant lines compared to susceptible controls, particularly in the early stages of establishing resistance. This correlation suggests the protein may be part of an inducible defense mechanism that is activated upon viral exposure. The temporal expression pattern indicates OtCpg00060 may be more important in the establishment rather than maintenance of resistance, as its expression often normalizes in stable resistant cultures maintained long-term in laboratory conditions .

What bioinformatic approaches can predict functional domains in OtCpg00060?

Despite being uncharacterized, researchers can employ several bioinformatic approaches to predict functional domains in OtCpg00060:

  • Transmembrane domain prediction using algorithms such as TMHMM, Phobius, or MEMSAT can identify potential membrane-spanning regions, which are critical for understanding the protein's topology.

  • Conserved domain analysis through databases like Pfam, SMART, or CDD can reveal functional motifs that might be shared with better-characterized proteins.

  • Secondary structure prediction tools including PSIPRED or JPred can provide insights into structural elements like alpha-helices and beta-sheets.

  • Homology modeling based on structurally characterized membrane proteins with similar sequences, even with low sequence identity, can generate testable hypotheses about three-dimensional organization.

  • Molecular dynamics simulations of the protein embedded in a lipid bilayer can offer insights into dynamic structural properties and potential interaction sites.

These computational approaches generate hypotheses that can guide experimental design for functional characterization studies, particularly for mapping protein-protein interaction domains or identifying regions critical for viral resistance functions .

How does the membrane topology of OtCpg00060 relate to its potential function?

The membrane topology of OtCpg00060 is critical to understanding its function in viral immunity. Based on sequence analysis and structural prediction algorithms, OtCpg00060 likely contains multiple transmembrane domains that anchor it within the cellular membrane. This topology suggests several potential functional mechanisms:

Experimental approaches to confirm these predictions include protease protection assays, fluorescence resonance energy transfer (FRET) studies, and site-directed mutagenesis of key residues in predicted functional domains. Understanding this topology is essential for developing targeted interventions or utilizing the protein as a model for studying membrane protein involvement in immunity .

What is known about post-translational modifications of OtCpg00060?

  • Multiple serine, threonine, and tyrosine residues throughout the sequence present possible phosphorylation sites that could regulate protein activity or interactions.

  • Several lysine residues may serve as ubiquitination sites, potentially affecting protein turnover or localization during immune responses.

  • The amino acid sequence contains potential glycosylation motifs that could be important for proper folding or interaction with viral components.

  • Conserved cysteine residues may form disulfide bonds critical for maintaining structural integrity.

To experimentally verify these predicted modifications, researchers would need to employ mass spectrometry-based proteomics approaches, including enrichment strategies for specific modifications. Additionally, site-directed mutagenesis of predicted modification sites followed by functional assays would help determine their biological significance in viral immunity contexts. The recombinant production of the protein in E. coli systems may limit some eukaryotic modifications, necessitating expression in more appropriate systems for comprehensive PTM characterization .

How can genome editing techniques be applied to study OtCpg00060 function in Ostreococcus tauri?

Genome editing approaches offer powerful tools for dissecting the function of OtCpg00060 in its native context:

  • CRISPR-Cas9 systems adapted for O. tauri can be used to introduce precise mutations, deletions, or insertions in the OtCpg00060 gene. This allows researchers to create knockout lines to assess loss-of-function phenotypes or to introduce specific mutations in predicted functional domains.

  • Homology-directed repair can be employed to insert reporter tags such as GFP or epitope tags into the endogenous gene, enabling visualization of protein localization and dynamics during viral infection.

  • Base editing or prime editing technologies may be used for introducing point mutations that alter specific amino acids without disrupting the entire gene, particularly useful for studying the role of predicted functional residues.

  • Inducible expression systems can be developed to control OtCpg00060 expression temporally, allowing researchers to determine when the protein is required during the viral resistance response.

These genetic manipulation approaches must account for the unique characteristics of O. tauri, including its small cell size, compact genome, and marine environment requirements. When combined with viral challenge assays, these techniques provide a comprehensive toolkit for determining the precise role of OtCpg00060 in viral immunity pathways .

What experimental approaches can identify interaction partners of OtCpg00060?

Identifying the interaction partners of OtCpg00060 is crucial for understanding its function in viral immunity pathways. Several complementary experimental approaches can be employed:

TechniqueAdvantageLimitationApplication to OtCpg00060
Co-immunoprecipitation (Co-IP)Captures native interactionsRequires specific antibodiesUsing anti-His tag antibodies with recombinant protein
Proximity labeling (BioID/APEX)Identifies transient interactionsCan generate false positivesFusing biotin ligase to OtCpg00060 in O. tauri cells
Yeast two-hybrid (Y2H)High-throughput screeningNot ideal for membrane proteinsModified split-ubiquitin Y2H for membrane interaction detection
Mass spectrometry after cross-linkingPreserves weak interactionsComplex data analysisApplying to purified recombinant protein in reconstituted systems
Förster resonance energy transfer (FRET)Real-time interaction analysisRequires fluorescent taggingVisualizing interactions during viral infection

For membrane proteins like OtCpg00060, techniques specifically adapted for hydrophobic proteins are preferred. The recombinant His-tagged protein provides a valuable tool for affinity purification approaches, while genetic approaches in the native organism can identify physiologically relevant interactions during viral infection responses .

What are the challenges in crystallizing membrane proteins like OtCpg00060 for structural studies?

Determining the high-resolution structure of membrane proteins like OtCpg00060 presents several significant challenges:

These challenges highlight why structural information for membrane proteins like OtCpg00060 remains limited despite their biological significance, and why integrated approaches combining partial structural data with computational modeling are often necessary .

What can we learn from comparing OtCpg00060 to similar proteins in viral resistance pathways?

Comparative analysis of OtCpg00060 with functionally characterized proteins involved in viral resistance pathways provides valuable insights:

  • Alignment with pattern recognition receptors (PRRs) from other organisms reveals potential conserved motifs involved in viral component recognition, helping to identify critical binding regions in OtCpg00060.

  • Comparison with membrane proteins known to block viral entry in other systems suggests potential mechanistic parallels, such as conformational changes upon viral contact or receptor competition.

  • Analysis of sequence similarities with immune signaling components indicates potential conserved interaction motifs that could connect OtCpg00060 to downstream defense pathways.

  • Examination of proteins involved in programmed cell death or viral replication restriction may highlight functional domains that OtCpg00060 shares with these immunity effectors.

This comparative approach is particularly valuable given OtCpg00060's uncharacterized status, as it allows researchers to generate testable hypotheses about protein function based on known mechanisms in better-studied systems. The differences identified may also highlight unique aspects of marine picoeukaryote immunity, potentially revealing novel antiviral mechanisms that have evolved in these organisms .

What are promising approaches for elucidating the mechanism of OtCpg00060 in viral resistance?

Several promising research approaches could significantly advance our understanding of OtCpg00060's role in viral resistance:

  • Time-course transcriptomic and proteomic profiling during viral infection to establish the temporal relationship between OtCpg00060 expression and activation of defense pathways.

  • Development of fluorescently-tagged OtCpg00060 variants to track protein localization and dynamics during viral challenge using super-resolution microscopy.

  • Creation of domain-specific mutants through systematic site-directed mutagenesis to map critical regions required for resistance function.

  • Application of hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes in the protein upon viral exposure.

  • Establishment of in vitro binding assays using purified components to determine if OtCpg00060 directly interacts with viral proteins or particles.

  • Cross-species complementation studies to determine if OtCpg00060 can confer similar resistance mechanisms when expressed in other organisms.

These integrated approaches would provide a comprehensive understanding of the protein's mechanism, potentially revealing novel antiviral strategies that could inform broader immunity research or biotechnological applications .

How might OtCpg00060 research contribute to understanding broader concepts in marine virus-host interactions?

Research on OtCpg00060 has significant implications for understanding broader concepts in marine virus-host interactions:

  • As Ostreococcus tauri is one of the smallest free-living eukaryotes, studying its viral immunity mechanisms through OtCpg00060 provides insights into minimal essential components required for effective antiviral responses in eukaryotic cells.

  • The marine environment presents unique selective pressures, and understanding how membrane proteins like OtCpg00060 function in high-salt conditions may reveal adaptation strategies specific to marine organisms.

  • Picoeukaryotes like O. tauri are ecologically significant as primary producers in marine ecosystems. Elucidating their viral resistance mechanisms helps explain bloom dynamics and carbon cycling in ocean environments.

  • The evolutionary history of OtCpg00060 may reveal patterns of co-evolution between marine viruses and their hosts, contributing to our understanding of the "arms race" that shapes marine microbial communities.

  • Comparative studies across different marine organisms may identify conserved or convergent antiviral strategies, potentially revealing universal principles in eukaryotic immunity that predate the evolution of more complex immune systems.

This research thus bridges molecular virology, marine ecology, and evolutionary biology, contributing to a more integrated understanding of host-pathogen interactions in marine ecosystems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.