Recombinant Uncharacterized membrane protein Rv0364/MT0380 (Rv0364, MT0380)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Basic Properties

Recombinant Uncharacterized membrane protein Rv0364/MT0380 is a protein encoded by the Mycobacterium tuberculosis genome. It is identified through multiple nomenclatures including Rv0364 (in the H37Rv reference strain), MT0380, and the ORF name MTCY13E10.26. The protein has been assigned the UniProt accession number O06314 . With a full sequence length of 227 amino acids, this protein has an approximate molecular weight of 24.5 kDa, classifying it as a relatively small protein within the mycobacterial proteome .

Genomic Organization

The gene encoding Rv0364/MT0380 is positioned within the Mycobacterium tuberculosis H37Rv genome, a reference strain commonly used in tuberculosis research. The expression region spans positions 1-227, indicating that the entire open reading frame is translated into the functional protein . This genetic organization suggests potential co-regulation with neighboring genes, though specific operonic structures have not been definitively established in the available research.

Evolutionary Conservation and Homology

Comparative genomic analyses reveal that Rv0364/MT0380 shares significant sequence similarity with other bacterial proteins, particularly within the Mycobacterium genus. Notably, it shows homology to Rv2637, another possible transmembrane protein from M. tuberculosis, with approximately 35.85% identity across a 184 amino acid overlap . This moderate level of conservation suggests divergent evolution from a common ancestral protein, potentially indicating specialized functions in different cellular contexts or environments.

Further homology has been observed with related proteins in other mycobacterial species. For context, the related protein Rv2637 belongs to the DedA family and shows similarities to proteins from various bacterial species including Mycobacterium leprae, Streptomyces coelicolor, Synechocystis sp., Deinococcus radiodurans, and Escherichia coli . This pattern of conservation across diverse bacterial species suggests fundamental cellular roles for this protein family.

Predicted Cellular Localization

Based on sequence analysis and structural predictions, Rv0364/MT0380 is classified as a membrane protein with multiple transmembrane domains . The presence of hydrophobic regions interspersed with charged amino acids suggests a topology where the protein spans the mycobacterial cell membrane multiple times. This membrane localization places Rv0364/MT0380 at a critical interface between the bacterial cytoplasm and its external environment, potentially mediating interactions with host cells or environmental factors.

Potential Functional Roles

While definitively characterized as "uncharacterized," several hypotheses regarding the function of Rv0364/MT0380 can be inferred from its structural features and homology to other proteins. As a membrane protein, it may participate in:

  1. Cellular transport mechanisms, possibly facilitating the movement of ions, nutrients, or signaling molecules across the mycobacterial membrane

  2. Cell wall maintenance and integrity, particularly important in Mycobacterium tuberculosis due to its unique cell wall structure

  3. Environmental sensing and signal transduction, potentially contributing to bacterial adaptation to host environments

  4. Virulence and pathogenicity, possibly through interactions with host cell components

The related protein Rv2637 is classified under the functional category "Cell wall and cell processes," providing further support for Rv0364/MT0380's potential involvement in cell envelope-related functions .

Expression and Purification

Recombinant Rv0364/MT0380 protein is produced through molecular cloning and heterologous expression systems, allowing for larger-scale production and detailed biochemical characterization. The recombinant version of this protein is typically expressed with affinity tags to facilitate purification, though the specific tag type may vary depending on the production process and intended applications . The expression region encompasses amino acids 1-227, representing the complete protein sequence.

Comparison with Related Proteins

The mycobacterial genome encodes several membrane proteins with structural similarities to Rv0364/MT0380. Most notably, Rv2637 (another possible transmembrane protein in M. tuberculosis) shares 35.85% sequence identity across a 184 amino acid overlap . This moderate level of homology suggests potential functional relationships while also indicating divergent specialization.

Both Rv0364/MT0380 and Rv2637 appear to belong to the broader DedA protein family, which includes members across various bacterial species . The DedA family comprises membrane proteins with diverse functions, many of which remain incompletely characterized despite their conservation across bacterial species.

Integration within the Mycobacterial Proteome

Within the broader context of mycobacterial biology, membrane proteins like Rv0364/MT0380 represent critical components of cellular architecture and function. The mycobacterial membrane and cell wall constitute a complex, lipid-rich barrier that contributes significantly to antibiotic resistance, immune evasion, and pathogenicity. Proteomic analyses have identified Rv0364/MT0380 in Triton X-114 extracts of M. tuberculosis, confirming its association with membrane fractions .

Available Research Reagents

Recombinant Rv0364/MT0380 protein is available as a research reagent, typically supplied in quantities of 50 μg or other customized amounts for experimental applications . These preparations allow researchers to conduct immunological, biochemical, and structural studies to better understand this protein's properties and potential functions. Specific applications include enzyme-linked immunosorbent assays (ELISA), where the recombinant protein can serve as a standard or coating antigen .

Potential Research Applications

The availability of purified recombinant Rv0364/MT0380 enables various research directions, including:

  1. Structural studies using X-ray crystallography or cryo-electron microscopy to determine three-dimensional structure

  2. Interaction studies to identify binding partners and molecular networks

  3. Immunological investigations to assess antigenic properties and potential as a diagnostic marker

  4. Drug development efforts targeting membrane proteins as novel therapeutic approaches for tuberculosis

Relevance to Pathogenesis and Virulence

While the specific function of Rv0364/MT0380 remains uncharacterized, its classification as a membrane protein suggests potential roles in mycobacterial pathogenesis. Membrane proteins often mediate critical interactions with host cells and immunity, contribute to nutrient acquisition in restrictive host environments, and participate in stress responses necessary for bacterial survival. Further characterization of Rv0364/MT0380 may reveal novel aspects of tuberculosis pathogenesis and bacterial adaptation within host environments.

Potential as a Therapeutic or Diagnostic Target

Mycobacterial membrane proteins represent attractive targets for therapeutic intervention due to their accessibility and essential functions. As research progresses on Rv0364/MT0380, it may emerge as a potential target for novel anti-tuberculosis drugs or diagnostic approaches. Comparative studies with related genes, such as those detailed in the expression data from ETZ treatment experiments, provide context for understanding differential expression patterns of mycobacterial genes under various conditions .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, please specify them in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. To enhance long-term storage stability, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard protocol uses a final glycerol concentration of 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Target Names
Rv0364, MT0380
Target Protein Sequence
MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFPLLPGESLLFTGGLLS ASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDSRFFKKHYVTESHAFFE KYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGVAWGAGVTLAGYFLGSVP FVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDPLVLPE
Uniprot No.

Q&A

What is the Rv0364/MT0380 protein and what organism does it originate from?

Rv0364/MT0380 is an uncharacterized membrane protein originating from Mycobacterium tuberculosis. The Rv designation indicates its gene location in the reference strain H37Rv genome, while MT0380 refers to its designation in clinical isolates. This protein has been assigned the UniProt accession number O06314, indicating it has been documented in protein databases but its specific function remains largely undetermined . As a membrane protein, it likely plays a role in cellular processes such as signaling, transport, or maintaining membrane integrity, though detailed functional characterization requires further investigation through biochemical and structural studies.

What are the optimal storage conditions for maintaining the stability of recombinant Rv0364/MT0380 protein?

The stability of recombinant Rv0364/MT0380 protein is significantly affected by storage conditions. For lyophilized preparations, a shelf life of approximately 12 months can be achieved when stored at -20°C to -80°C . Liquid formulations have a reduced stability profile, with an estimated shelf life of 6 months under similar temperature conditions . Working aliquots should be stored at 4°C and used within one week to maintain optimal activity . It is critically important to avoid repeated freeze-thaw cycles, as these can substantially compromise protein integrity and function through denaturation and aggregation . For long-term storage, reconstituted protein should be supplemented with glycerol (typically 50% final concentration) and stored in small single-use aliquots at -80°C to maximize stability while minimizing freeze-thaw damage .

What is the recommended protocol for reconstituting lyophilized Rv0364/MT0380 protein?

The recommended reconstitution protocol for lyophilized Rv0364/MT0380 protein involves several critical steps to ensure optimal protein recovery and activity. First, the vial should be briefly centrifuged to ensure all lyophilized material is at the bottom before opening . The protein should then be reconstituted in deionized sterile water to a final concentration between 0.1-1.0 mg/mL . For long-term storage applications, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the standard default concentration for maximum stability . This glycerol addition serves as a cryoprotectant that helps prevent protein denaturation during freeze-thaw cycles. After reconstitution, the solution should be gently mixed to ensure complete solubilization without introducing excess air bubbles that could promote oxidation and protein aggregation.

How can the purity of recombinant Rv0364/MT0380 be verified for experimental applications?

The purity of recombinant Rv0364/MT0380 protein can be verified through multiple analytical techniques, with SDS-PAGE being the primary method employed for quality control. Commercial preparations typically ensure a purity of >85% as determined by SDS-PAGE analysis . For more rigorous experimental applications, researchers should consider employing complementary analytical methods. Size exclusion chromatography (SEC) can provide information about aggregation states and homogeneity of the protein preparation. Mass spectrometry approaches, particularly LC-MS/MS, can confirm protein identity and detect potential contaminants or degradation products. Western blotting using antibodies specific to either the protein itself or to the tag used in purification can further validate protein identity. For membrane proteins like Rv0364/MT0380, additional consideration should be given to detergent selection during these analyses to maintain protein stability while enabling accurate purity assessment.

What detergents are most effective for solubilizing Rv0364/MT0380 while maintaining its native conformation?

The selection of appropriate detergents for solubilizing membrane proteins like Rv0364/MT0380 is critical for maintaining native protein conformation and function. While specific detergent optimization data for Rv0364/MT0380 is not explicitly provided in the available literature, general principles for mycobacterial membrane protein solubilization can be applied. Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin often provide a good starting point as they balance solubilization efficiency with gentleness toward protein structure. For initial screening, researchers should establish a detergent panel testing various critical micelle concentrations (CMCs). Functional assays or thermal stability measurements using techniques like differential scanning fluorimetry (DSF) can then be employed to evaluate which detergent best preserves the protein's native state. For downstream structural or functional studies, detergent exchange may be necessary, potentially incorporating amphipols or nanodiscs to provide a more membrane-like environment.

What structural characterization approaches are most suitable for membrane proteins like Rv0364/MT0380?

Structural characterization of membrane proteins like Rv0364/MT0380 presents unique challenges requiring specialized approaches. X-ray crystallography remains valuable but demands highly pure, homogeneous protein samples in appropriate detergent micelles or lipidic cubic phases. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, particularly for membrane proteins that resist crystallization, allowing visualization in near-native environments using detergent micelles, nanodiscs, or amphipols. Nuclear magnetic resonance (NMR) spectroscopy, especially solution NMR for smaller membrane proteins or solid-state NMR, can provide atomic-level structural insights and dynamic information. Complementary techniques include hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping solvent-accessible regions and protein dynamics, small-angle X-ray scattering (SAXS) for low-resolution envelope determination, and circular dichroism (CD) spectroscopy for secondary structure assessment. A multi-technique approach often yields the most comprehensive structural understanding of challenging membrane proteins like Rv0364/MT0380.

How can researchers determine the membrane topology and orientation of Rv0364/MT0380?

Determining the membrane topology and orientation of Rv0364/MT0380 requires a strategic combination of computational prediction and experimental validation techniques. Computational approaches should begin with transmembrane domain prediction using algorithms such as TMHMM, HMMTOP, or Phobius, which analyze the protein sequence to identify potential membrane-spanning regions. These predictions can be complemented by hydropathy analysis and homology modeling if structural templates exist. Experimentally, the gold standard approach involves cysteine scanning mutagenesis, where single cysteine residues are systematically introduced throughout the protein sequence and their accessibility to membrane-impermeable sulfhydryl reagents is assessed. Protease protection assays, in which the protein is subjected to proteolytic digestion followed by mass spectrometry analysis of the protected fragments, can reveal which portions are shielded by the membrane. Fluorescence techniques using environment-sensitive probes or antibody accessibility studies in intact versus permeabilized cells provide additional evidence for topology mapping. These approaches collectively yield a comprehensive topological model essential for understanding protein function.

What functional assays can be employed to characterize the potential role of Rv0364/MT0380 in Mycobacterium tuberculosis?

Characterizing the functional role of uncharacterized membrane proteins like Rv0364/MT0380 in Mycobacterium tuberculosis requires a multi-faceted experimental approach. Gene knockout or knockdown studies using CRISPR-Cas9 or antisense RNA techniques can assess the protein's essentiality and phenotypic effects on bacterial growth, virulence, and stress responses. Complementary to genetic approaches, protein-protein interaction studies using pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation followed by mass spectrometry can identify binding partners that provide functional context. For potential transport functions, liposome reconstitution assays measuring substrate flux across membranes can be employed. Transcriptomic and proteomic profiling comparing wild-type and mutant strains under various conditions may reveal affected pathways. Additionally, comparing expression patterns across different growth conditions, particularly those mimicking in-host environments, can provide clues about function during infection. Structure-function studies combining mutagenesis of conserved residues with activity measurements further elucidate mechanistic details of this uncharacterized membrane protein.

What bioinformatic approaches can predict potential functions of Rv0364/MT0380 based on sequence and structural features?

Predicting the potential functions of uncharacterized proteins like Rv0364/MT0380 requires an integrated bioinformatic approach leveraging multiple computational tools. Sequence-based methods should begin with homology searches using PSI-BLAST and HHpred to identify distant relatives with known functions. Conserved domain analysis using databases like Pfam, SMART, and InterPro can identify functional modules within the protein sequence. For membrane proteins specifically, topology prediction tools (TMHMM, HMMTOP) provide insights into transmembrane organization. Structure prediction using AlphaFold2 or RoseTTAFold can generate three-dimensional models to identify potential binding pockets or active sites. Genomic context analysis examining gene neighborhood conservation across mycobacterial species can suggest functional associations. Integrating these predictions with available experimental data on protein-protein interactions, essentiality screening results, and transcriptional responses to environmental conditions provides a comprehensive functional hypothesis. The final predicted function should be assigned confidence levels based on the consistency across multiple prediction methods and supported by experimental validation planning.

How can researchers effectively compare the expression profiles of Rv0364/MT0380 with other mycobacterial membrane proteins to infer functional relationships?

Effective comparison of expression profiles between Rv0364/MT0380 and other mycobacterial membrane proteins requires sophisticated analytical approaches to extract meaningful functional relationships. Researchers should begin by normalizing expression data using appropriate statistical methods to account for technical variation across experiments. Hierarchical clustering and principal component analysis can then be applied to identify proteins with similar expression patterns across multiple conditions, as demonstrated in comprehensive mycobacterial transcriptomic datasets . When examining specific stress responses or drug treatments, researchers should analyze co-regulated gene clusters that include Rv0364/MT0380 to identify potential functional modules. Correlation networks constructed from expression data can visualize protein associations, with edge weights representing correlation strength. For advanced analysis, weighted gene co-expression network analysis (WGCNA) can detect modules of highly correlated genes across complex datasets. Comparison with expression profiles of characterized membrane proteins involved in processes like transport, signaling, or cell wall maintenance may provide clues to Rv0364/MT0380's function. Finally, integration with protein-protein interaction data and genetic interaction screens strengthens the evidence for predicted functional relationships derived from expression profile comparisons.

What controls should be included when performing functional studies with recombinant Rv0364/MT0380?

When designing functional studies with recombinant Rv0364/MT0380, a comprehensive control strategy is essential for result validation. Negative controls should include vector-only or irrelevant protein expressions processed identically to Rv0364/MT0380 samples to account for background effects from the expression system. Positive controls utilizing well-characterized membrane proteins from Mycobacterium with established functional assays provide benchmarks for expected results. For knockout or knockdown studies, complementation controls where the wild-type protein is reintroduced confirm phenotype specificity. When studying protein-protein interactions, both N- and C-terminally tagged versions should be tested to ensure tag position doesn't interfere with protein function. Heat-inactivated or key-residue mutated versions of Rv0364/MT0380 serve as important activity controls. For localization studies, fractionation quality controls using markers for different cellular compartments ensure proper separation. Finally, dose-response experiments across a range of protein concentrations establish relationship linearity and help identify optimal working concentrations. This multi-level control strategy enables confident interpretation of experimental results concerning this uncharacterized membrane protein.

How should researchers approach the challenge of differentiating between direct and indirect effects in Rv0364/MT0380 functional studies?

Differentiating between direct and indirect effects in Rv0364/MT0380 functional studies requires a carefully designed experimental strategy. Time-course experiments monitoring changes after protein induction or deletion can help distinguish primary (rapid) from secondary (delayed) effects. Dose-dependency studies establishing correlation between protein concentration and observed phenotypes support direct relationships. Complementary approaches include in vitro reconstitution systems using purified components to demonstrate sufficiency for the observed function without cellular factors. Site-directed mutagenesis targeting predicted functional residues can confirm specific mechanistic hypotheses—if mutation abolishes function without affecting protein stability, direct involvement is supported. Chemical genetic approaches using small molecule inhibitors with rapid onset of action can provide temporal resolution difficult to achieve with genetic methods. Proximity-based labeling techniques like BioID or APEX can identify proteins in close physical proximity to Rv0364/MT0380 in vivo. For comprehensive understanding, systems biology approaches integrating transcriptomic, proteomic, and metabolomic data after perturbation of Rv0364/MT0380 can help construct causal networks distinguishing direct from indirect effects through computational modeling of response dynamics.

What are the critical considerations when designing expression constructs for structural and functional studies of Rv0364/MT0380?

Designing effective expression constructs for Rv0364/MT0380 structural and functional studies demands careful consideration of multiple factors. Tag selection and placement are critical—while N-terminal tags may be preferable for secreted proteins, C-terminal tags are often better for membrane proteins to avoid interfering with signal sequences or transmembrane domains. Flexible linkers (e.g., GGGS repeats) between the protein and tag can minimize functional interference. Codon optimization for the expression host improves yield, but researchers should be cautious as this can sometimes affect protein folding. For structural studies, construct design should incorporate predicted domain boundaries to generate stable, well-folded proteins. Removal of flexible regions identified through disorder prediction algorithms can improve crystallization prospects. Expression vector selection should consider induction system compatibility with membrane protein expression—often lower temperature induction and slower expression rates improve folding. For functional studies, the construct should include native promoter elements if studying regulation is important. Multiple constructs with varying boundaries should be prepared in parallel to identify optimal expression and stability conditions through small-scale expression screening. Finally, validation of protein folding through techniques like circular dichroism or fluorescence-based thermal shift assays ensures the recombinant protein maintains native-like characteristics.

What insights can be gained by comparing Rv0364/MT0380 with homologous proteins in non-tuberculosis mycobacterial species?

Comparative analysis of Rv0364/MT0380 with homologous proteins in non-tuberculosis mycobacterial species provides valuable evolutionary and functional insights. This approach begins with comprehensive homology searches across mycobacterial genomes to identify orthologs and paralogs. Sequence conservation analysis can highlight regions under evolutionary constraint, suggesting functional importance. Particularly interesting would be comparing Rv0364/MT0380 with homologs in pathogenic (M. leprae, M. ulcerans) versus non-pathogenic mycobacteria (M. smegmatis), as conservation patterns may reveal adaptations related to virulence or pathogenicity. Synteny analysis examining gene neighborhood conservation across species can indicate functional associations preserved through evolution. Comparative structural modeling of homologs may reveal conserved binding pockets or interaction surfaces. Researchers should also analyze expression data across species to identify conserved regulatory patterns in response to environmental stimuli or stress conditions. If experimental phenotypic data exists for homolog mutations in model mycobacteria like M. smegmatis, these can provide testable hypotheses for Rv0364/MT0380 function. Together, these comparative approaches create an evolutionary framework for understanding functional constraints and specializations of this uncharacterized membrane protein across the mycobacterial genus.

How can researchers leverage data from gene knockout libraries to understand the functional significance of Rv0364/MT0380?

Researchers can extract valuable functional insights about Rv0364/MT0380 by systematically analyzing data from gene knockout libraries in Mycobacterium tuberculosis. Transposon mutagenesis studies like TraSH (Transposon Site Hybridization) or TnSeq (Transposon Sequencing) provide genome-wide essentiality data under various conditions. By examining the insertion frequency within Rv0364/MT0380, researchers can determine if it is essential for basic viability, conditionally essential under specific stresses, or non-essential. Comparative analysis of essentiality profiles across different growth conditions (nutrient limitation, hypoxia, acid stress, host-mimicking environments) can reveal condition-specific requirements for Rv0364/MT0380. Researchers should also examine the essentiality patterns of genes with similar expression profiles to identify potential functional relationships. Genetic interaction mapping through double-knockout libraries can identify synthetic lethal interactions, revealing compensatory pathways or protein complexes involving Rv0364/MT0380. For non-essential genes, phenotypic characterization of knockout mutants examining growth rates, morphology, stress resistance, and virulence in infection models provides direct functional evidence. Integration of essentiality data with other omics datasets (transcriptomics, proteomics, metabolomics) enables construction of comprehensive functional networks positioning Rv0364/MT0380 within the broader cellular context of Mycobacterium tuberculosis biology.

What are the most promising research directions for further characterizing the function of Rv0364/MT0380?

The most promising research directions for characterizing Rv0364/MT0380 function involve an integrated multi-disciplinary approach. High-resolution structural determination through cryo-EM or X-ray crystallography would provide critical insights into potential binding sites and functional domains. Comprehensive protein-protein interaction mapping using approaches like proximity labeling followed by mass spectrometry could identify binding partners and potential complexes involving Rv0364/MT0380. Targeted gene knockout studies combined with phenotypic profiling under diverse stress conditions relevant to tuberculosis pathogenesis would reveal condition-specific requirements. Lipidomic and metabolomic analysis of knockout strains may uncover alterations in membrane composition or metabolic pathways. For potential transport functions, reconstitution into proteoliposomes coupled with substrate screening would identify transported molecules. Single-cell analysis examining expression heterogeneity across bacterial populations could reveal regulatory patterns and cell state-specific roles. Integration of multi-omics data through systems biology approaches would position Rv0364/MT0380 within functional networks. Given the importance of membrane proteins as drug targets, targeted inhibitor screening campaigns could simultaneously advance therapeutic development while validating protein function. Together, these approaches would provide complementary lines of evidence converging on a comprehensive functional understanding of this currently uncharacterized membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.