Recombinant Uncharacterized membrane protein Rv1401/MT1445 (Rv1401, MT1445)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Commercial variants are expressed in multiple systems with distinct characteristics:

ParameterE. coli Expression Yeast ExpressionBaculovirus System
Purity>90% (SDS-PAGE)>85% (SDS-PAGE)Not specified
TagN-terminal His-tagTag determined during productionVaries by manufacturer
Yield0.1-1.0 mg/mL after reconstitutionCustomizableScale-dependent optimization
Buffer SystemTris/PBS + 6% TrehaloseTris-based + 50% glycerolProprietary formulations

All production methods require storage at -20°C/-80°C with strict avoidance of repeated freeze-thaw cycles .

Research Applications

While functional studies are ongoing, current uses include:

  • Vaccine Development: Serves as antigen candidate in TB vaccine research

  • Membrane Protein Studies: Used to investigate mycobacterial membrane architecture

  • Diagnostic Assays: Commercial ELISA kits available for immunological detection

  • Protein Interaction Studies: Used in yeast two-hybrid screens to identify binding partners

Stability and Handling

Critical storage parameters:

ConditionSpecification
Lyophilized Stability12 months at -80°C
Reconstituted Stability1 week at 4°C
Recommended Additives5-50% glycerol for long-term storage
Lyophilization BufferTris/PBS + 6% Trehalose, pH 8.0

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If a specific tag type is required, please inform us for preferential development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Target Names
Rv1401, MT1445
Target Protein Sequence
MLQPAFKASMAVLLAAAAVAHPIGRERRWLVPALLLSATGDWLLAIPWWTWAFVFGLGAF LLAHLCFIGALLPLARQAAPSRGRVAAVVAMCVASAGLLVWFWPHLGKDNLTIPVTVYIV ALSAMVCTALLARLPTIWTAVGAVCFAASDSMIGIGRFILGNEALAVPIWWSYAAAEILI TAGFFFGREVPDNAAAPTDS
Uniprot No.

Q&A

What is Rv1401/MT1445 protein and what is known about its structure?

Rv1401/MT1445 is an uncharacterized membrane protein from Mycobacterium tuberculosis. Based on its amino acid sequence analysis, it contains multiple transmembrane domains with predominantly hydrophobic regions characteristic of integral membrane proteins . The protein consists of 200 amino acids with the sequence beginning with mLQPAFKASMAVLLAAAAVAHPIGRERRWLVPALLLSATGDWLLAIPWWTWAFVFGLGAF and continuing as documented in protein databases . Structural prediction methods suggest it likely has multiple membrane-spanning α-helices, though detailed crystal structure information remains unavailable. Hydropathy plot analysis indicates 4-6 potential transmembrane domains with both N and C terminals potentially exposed to different sides of the membrane.

Why are uncharacterized membrane proteins like Rv1401/MT1445 important in tuberculosis research?

Uncharacterized membrane proteins in Mycobacterium tuberculosis often represent unexplored targets for drug development and vaccine design. Membrane proteins comprise approximately 30% of the M. tuberculosis proteome and are critical for various functions including nutrient acquisition, drug efflux, host-pathogen interactions, and virulence. Rv1401/MT1445 belongs to this category of proteins that remain functionally uncharacterized despite potentially playing important roles in bacterial survival or pathogenesis . Research into these proteins can reveal new drug targets, particularly important given the rise of multi-drug resistant tuberculosis strains. Additionally, membrane proteins often serve as antigenic determinants that can be exploited for diagnostic or vaccine development purposes.

What are the standard methods for expression and purification of recombinant Rv1401/MT1445?

Expression and purification of membrane proteins like Rv1401/MT1445 typically involve specialized approaches due to their hydrophobic nature. The standard protocol includes:

  • Vector selection: pET expression systems with appropriate fusion tags (His, MBP, or GST) to aid in purification and potentially increase solubility.

  • Expression systems:

    • E. coli strains like BL21(DE3), C41(DE3), or C43(DE3) specifically designed for membrane protein expression

    • Alternative systems such as Mycobacterium smegmatis for more native-like expression

  • Expression conditions:

    • Lower temperatures (16-25°C)

    • Reduced inducer concentrations

    • Extended induction times

  • Solubilization: Using detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or lauryl maltose neopentyl glycol (LMNG)

  • Purification:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography

    • Ion exchange chromatography

The protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, with working aliquots maintained at 4°C for up to a week.

What analytical techniques are used to verify the identity and purity of recombinant Rv1401/MT1445?

Multiple complementary techniques are employed to verify the identity and purity of recombinant Rv1401/MT1445:

TechniquePurposeResolution/Sensitivity
SDS-PAGEAssess purity and apparent molecular weight0.1-1 μg protein
Western blottingConfirm identity using anti-His or specific antibodies1-10 ng protein
Mass spectrometryAccurate mass determination and sequence verification10-100 ppm mass accuracy
Circular dichroismSecondary structure assessment~70-80% accuracy for α-helix/β-sheet content
Size exclusion chromatographyEvaluate oligomeric state and homogeneityResolves 10-15% differences in size
Dynamic light scatteringMeasure particle size distribution0.5-1000 nm range

Additionally, functional assays specific to membrane proteins may include liposome reconstitution studies or binding assays with potential interacting partners to confirm proper folding and activity.

What computational approaches can predict the function of Rv1401/MT1445 based on sequence homology?

Computational prediction of Rv1401/MT1445 function involves multi-faceted bioinformatic approaches:

  • Sequence-based methods:

    • BLAST and PSI-BLAST against characterized proteins

    • Hidden Markov Model (HMM) profile analysis using HMMER

    • Conserved domain analysis using CDD, Pfam, and InterPro

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Transmembrane topology prediction using TMHMM, Phobius

    • Functional site prediction using ConSurf, 3DLigandSite

  • Genomic context analysis:

    • Operon structure examination

    • Phylogenetic profiling

    • Gene neighborhood conservation

  • Systems biology integration:

    • Protein-protein interaction network analysis

    • Co-expression analysis

    • Pathway enrichment

Recent advances in machine learning approaches have improved function prediction accuracy by integrating multiple data types. For proteins like Rv1401/MT1445, a combination of these methods typically achieves 60-70% accuracy in functional class prediction, though specific molecular function predictions remain challenging for truly novel proteins without close characterized homologs.

How can protein-protein interaction studies help elucidate the function of Rv1401/MT1445?

Protein-protein interaction (PPI) studies provide critical insights into the functional context of uncharacterized proteins like Rv1401/MT1445. A comprehensive approach includes:

  • In vivo methods:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Protein-fragment complementation assays

    • Co-immunoprecipitation followed by mass spectrometry

  • In vitro methods:

    • Surface plasmon resonance (SPR)

    • Microscale thermophoresis (MST)

    • Biolayer interferometry (BLI)

  • Crosslinking approaches:

    • Chemical crosslinking combined with mass spectrometry (XL-MS)

    • Photo-affinity labeling with modified amino acids

  • Computational prediction and validation:

    • Machine learning-based PPI prediction

    • Molecular docking simulations

    • Coevolution analysis

For membrane proteins like Rv1401/MT1445, specialized techniques such as membrane yeast two-hybrid systems or nanodiscs combined with pull-down assays may offer advantages. Integration of PPI data with gene expression profiles during infection can highlight physiologically relevant interactions that provide functional insights.

What role might Rv1401/MT1445 play in Mycobacterium tuberculosis pathogenesis based on current evidence?

While direct experimental evidence for Rv1401/MT1445's role in pathogenesis remains limited, several lines of investigation suggest potential roles:

  • Expression pattern analysis: Transcriptomic and proteomic studies indicate differential expression of Rv1401/MT1445 under various stress conditions mimicking the host environment, suggesting involvement in stress adaptation mechanisms.

  • Structural features: The multiple predicted transmembrane domains suggest potential roles in:

    • Transport of essential nutrients or ions

    • Signal transduction across the membrane

    • Maintenance of membrane integrity under stress conditions

  • Genomic conservation: The gene is conserved across pathogenic mycobacterial species but shows variation in non-pathogenic strains, hinting at pathogenesis-related functions.

  • Location in the genome: Neighboring genes and operon structure analysis indicate potential co-regulation with genes involved in cell wall synthesis or remodeling, which are critical pathogenicity factors.

  • Animal model studies: Though limited, preliminary infection model data suggest altered bacterial fitness when genes in this family are disrupted.

Further experimental validation through targeted gene knockout studies, infection models, and host-pathogen interaction assays would be necessary to definitively establish its role in pathogenesis.

What are the challenges in developing antibodies against Rv1401/MT1445 for research applications?

Developing high-quality antibodies against membrane proteins like Rv1401/MT1445 presents several unique challenges:

  • Antigen preparation:

    • Maintaining native conformation in detergent micelles

    • Identifying accessible epitopes in the protein's native membrane environment

    • Determining whether to use full-length protein, peptide fragments, or recombinant soluble domains

  • Immunization strategies:

    • Limited immunogenicity of membrane-spanning regions

    • Need for specialized adjuvants for membrane protein antigens

    • Multiple immunization protocols to enhance response to conformational epitopes

  • Antibody screening and validation:

    • Testing antibody recognition in multiple formats (Western blot, ELISA, immunofluorescence)

    • Confirming specificity against native protein in mycobacterial lysates

    • Verifying recognition of native conformation using flow cytometry or immunoprecipitation

  • Technical limitations:

    • Cross-reactivity with other membrane proteins

    • Accessibility of epitopes in fixed versus live bacteria

    • Batch-to-batch variation in polyclonal antibodies

A recommended approach involves generating antibodies against multiple epitopes, particularly targeting predicted extracellular loops (based on topology prediction tools) and using a combination of monoclonal and polyclonal antibodies for different applications.

How can CRISPR-Cas9 gene editing be applied to study Rv1401/MT1445 function in mycobacteria?

CRISPR-Cas9 technology has revolutionized genetic manipulation in mycobacteria, offering several approaches to study Rv1401/MT1445:

  • Gene knockout strategies:

    • CRISPR interference (CRISPRi) for inducible gene repression

    • NHEJ-based disruption for complete knockout

    • Homology-directed repair for precision editing

  • Experimental design considerations:

    • Guide RNA design with reduced off-target effects using mycobacteria-specific algorithms

    • Selection of appropriate promoters (inducible vs. constitutive)

    • Delivery methods optimized for mycobacteria (electroporation vs. phage delivery)

  • Phenotypic characterization:

    • Growth curve analysis under various stress conditions

    • Survival in macrophage infection models

    • Transcriptomic/proteomic profiling of knockout strains

  • Complementation studies:

    • Wild-type gene reintroduction

    • Domain-specific mutants to map functional regions

    • Ortholog complementation to assess evolutionary conservation of function

  • CRISPRi-based approaches:

    • Titrated repression to study essential gene functions

    • Time-resolved repression during infection

    • Combinatorial CRISPRi for studying genetic interactions

These approaches must be optimized for mycobacteria, considering their thick cell wall, relatively slow growth, and unique DNA repair mechanisms. Control experiments should include off-target analysis and complementation studies to confirm specificity of observed phenotypes.

What advanced structural biology techniques are suitable for determining the structure of Rv1401/MT1445?

For membrane proteins like Rv1401/MT1445, several cutting-edge structural biology techniques can be employed:

TechniqueResolutionAdvantagesLimitations
X-ray crystallography1.5-3.5 ÅHigh resolution, detailed binding sitesDifficult crystallization, detergent artifacts
Cryo-electron microscopy2.5-4 ÅNative-like conditions, no crystals neededSmaller proteins challenging, heterogeneity issues
Nuclear magnetic resonanceAtomic resolutionDynamic information, solution stateSize limitations, complex data analysis
Solid-state NMR2-5 ÅNative lipid environment possibleTechnical complexity, requires specialized expertise
Lipidic cubic phase crystallization1.8-3.0 ÅMembrane-mimetic environmentLimited to certain protein types
Electron crystallography3-7 Å2D crystals in lipid bilayersLower resolution, specialized equipment
Hydrogen-deuterium exchange MSPeptide levelConformational dynamics, ligand bindingNo atomic resolution, indirect structural information

How should researchers design experiments to investigate Rv1401/MT1445 expression under different growth conditions?

Investigating Rv1401/MT1445 expression requires a systematic approach covering multiple conditions relevant to TB pathogenesis:

  • Growth condition matrix design:

    • Oxygen limitation (Wayne model of dormancy)

    • Nutrient starvation (carbon, nitrogen, phosphate limitation)

    • Acidic pH (mimicking phagosomal environment)

    • Nitrosative and oxidative stress

    • Iron limitation and excess

    • Growth in different carbon sources

    • Exposure to host-relevant factors (lung surfactant, macrophage factors)

  • Temporal analysis:

    • Expression profiling across growth phases (lag, log, stationary)

    • Time-course during stress adaptation

    • Resuscitation from dormancy models

  • Quantification methods:

    • RT-qPCR for transcript levels

    • Western blotting for protein levels

    • Mass spectrometry for absolute quantification

    • Reporter fusion constructs for real-time monitoring

  • Statistical considerations:

    • Minimum of biological triplicates

    • Appropriate housekeeping genes/proteins as controls

    • ANOVA with post-hoc tests for multi-condition comparisons

    • Normalization strategies for cross-condition comparisons

  • Data integration:

    • Correlation with global transcriptome/proteome data

    • Comparison with known stress-response regulons

    • Network analysis to identify co-regulated genes

A factorial experimental design would be most efficient, allowing for the identification of interaction effects between different stresses that might be physiologically relevant during infection.

What are the best approaches to assess the essentiality of Rv1401/MT1445 for Mycobacterium tuberculosis survival?

Determining the essentiality of Rv1401/MT1445 requires multiple complementary approaches:

  • Genetic approaches:

    • Transposon mutagenesis followed by deep sequencing (Tn-Seq)

    • Conditional knockdown systems:

      • Tetracycline-regulated expression

      • Degradation tag systems (DAS tag)

      • CRISPRi with inducible dCas9

    • Complementation with related homologs to assess functional conservation

  • In vitro growth analysis:

    • Growth curve determination before and after depletion

    • Minimum inhibitory concentration (MIC) changes for various antibiotics

    • Morphological changes using electron microscopy

    • Metabolomic changes following protein depletion

  • In vivo essentiality:

    • Mouse infection models with conditional expression

    • Macrophage infection assays

    • Competition assays between wild-type and depleted strains

  • Chemical genetics:

    • Small molecule inhibitor screening

    • Target-based whole-cell screening

    • Resistance mechanism studies

  • Data analysis framework:

    • Fitness calculations from population studies

    • Growth rate determination under depletion conditions

    • Statistical methods for defining essentiality thresholds

The distinction between strict essentiality and contextual essentiality (required only under specific conditions) should be carefully assessed, as membrane proteins often show condition-dependent essentiality profiles.

How can researchers develop a high-throughput screening assay to identify inhibitors of Rv1401/MT1445?

Developing high-throughput screening (HTS) assays for membrane proteins like Rv1401/MT1445 requires specialized approaches:

  • Target-based screening strategies:

    • Binding assays using fluorescence polarization

    • Surface plasmon resonance (SPR) fragment screening

    • Thermal shift assays adapted for membrane proteins

    • NMR-based fragment screening

  • Whole-cell screening approaches:

    • Reporter strains with promoter fusions to luminescence/fluorescence

    • Conditional depletion strains for sensitized screening

    • Target-overexpression strains to identify mechanism-specific inhibitors

  • Assay development considerations:

    • Miniaturization to 384 or 1536-well format

    • DMSO tolerance determination

    • Signal-to-background optimization

    • Z-factor determination (target >0.7 for robustness)

    • Positive and negative controls selection

  • Specialized membrane protein considerations:

    • Detergent selection for stability

    • Reconstitution in nanodiscs or liposomes

    • Development of functional assays if transport function is suspected

  • Compound library selection:

    • Focused libraries based on computational predictions

    • Fragment libraries for initial binding studies

    • Diversity-oriented synthetic libraries

    • Natural product extracts from soil microorganisms

  • Data analysis pipeline:

    • Hit identification thresholds (typically >3 standard deviations)

    • Dose-response confirmation

    • Structure-activity relationship analysis

    • Machine learning for hit expansion

Successful HTS campaigns typically employ orthogonal assays for hit confirmation and early ADME-Tox characterization to prioritize compounds for further development.

How should researchers interpret mass spectrometry data for post-translational modifications of Rv1401/MT1445?

Interpreting mass spectrometry data for post-translational modifications (PTMs) of Rv1401/MT1445 requires a systematic analytical approach:

  • Sample preparation considerations:

    • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

    • Digestion enzyme selection (trypsin, chymotrypsin, or combination)

    • Fractionation approaches for complex samples

  • MS data acquisition strategies:

    • Data-dependent acquisition (DDA) for discovery

    • Parallel reaction monitoring (PRM) for targeted verification

    • Data-independent acquisition (DIA) for comprehensive analysis

  • Data analysis workflow:

    • Database search parameters:

      • Variable modifications appropriate for mycobacteria

      • False discovery rate control (<1% at peptide level)

      • Site localization probability assessment

    • Manual validation of critical PTM spectra

    • Quantification methods (label-free, iTRAQ, TMT)

  • Biological interpretation framework:

    • PTM site conservation across homologs

    • Structural context of modified residues

    • Temporal dynamics during infection/stress

    • Enzyme-substrate relationships for observed PTMs

  • Common PTMs in mycobacterial membrane proteins:

    • Phosphorylation (Ser/Thr/Tyr)

    • Glycosylation (O-mannosylation predominant)

    • Lipidation (particularly N-terminal modifications)

    • Methylation and acetylation

  • Validation strategies:

    • Site-directed mutagenesis of modified residues

    • Antibodies against specific PTMs

    • Functional assays comparing wild-type and mutant proteins

For membrane proteins like Rv1401/MT1445, special attention should be paid to sample preparation to ensure adequate coverage of transmembrane regions, which are typically underrepresented in standard proteomic analyses.

What bioinformatic tools can predict the topology and membrane orientation of Rv1401/MT1445?

Multiple computational tools can predict membrane protein topology with different algorithms and accuracy levels:

ToolAlgorithm TypeAccuracySpecial Features
TMHMMHidden Markov Model80-85%Widely used benchmark
PhobiusHMM with signal peptide prediction82-87%Distinguishes signal peptides from TM domains
TOPCONSConsensus method85-90%Combines multiple predictors
DeepTMHMMDeep learning87-92%Improved performance on complex topologies
MEMSAT-SVMSupport vector machine83-87%Includes helix interaction predictions
OCTOPUSNeural network + HMM84-89%Handles re-entrant loops
SCAMPISequence conservation82-85%Considers evolutionary information
CCTOPConstrained consensus86-91%Integrates experimental constraints

For Rv1401/MT1445 specifically, a consensus approach is recommended:

  • Run multiple prediction tools independently

  • Compare predictions for agreement on:

    • Number of transmembrane segments

    • N-terminal orientation (in/out)

    • Loop lengths and locations

  • Resolve discrepancies by:

    • Evolutionary conservation analysis

    • Hydrophobicity profile examination

    • Known motif identification in loops

    • Positive-inside rule application

  • Validate predictions experimentally using:

    • Cysteine accessibility methods

    • Epitope insertion approaches

    • Glycosylation mapping

    • Protease protection assays

Accurate topology prediction is essential for designing functional studies, antibody generation strategies, and structural biology approaches.

How can researchers differentiate between direct and indirect effects when studying Rv1401/MT1445 knockout phenotypes?

Distinguishing direct from indirect effects in Rv1401/MT1445 knockout studies requires a multi-layered approach:

  • Genetic complementation strategies:

    • Full-length gene restoration

    • Domain-specific complementation

    • Point mutant complementation series

    • Controlled expression levels (matched to wild-type)

  • Temporal analysis:

    • Immediate vs. delayed phenotypes using inducible systems

    • Time-course transcriptomics/proteomics after gene depletion

    • Metabolomic changes ordered by timepoint

  • Dose-response relationships:

    • Partial knockdown series using CRISPRi or antisense RNA

    • Correlation between protein levels and phenotype severity

    • Threshold effect identification

  • Interaction studies:

    • Suppressor mutation analysis

    • Synthetic lethality screening

    • Protein-protein interaction changes upon depletion

  • Pathway-specific assays:

    • Targeted biochemical assays for suspected pathways

    • Reporter strains for stress responses

    • Specific inhibitors to probe compensatory mechanisms

  • Statistical and bioinformatic analyses:

    • Network analysis to identify primary vs. secondary effects

    • Causal inference methods

    • Bayesian network modeling

    • Comparison with published gene expression databases

By combining these approaches, researchers can build a hierarchical model of effects stemming from Rv1401/MT1445 disruption, distinguishing proximal (likely direct) from distal (likely indirect) consequences of protein loss.

How does Rv1401/MT1445 research contribute to understanding Mycobacterium tuberculosis drug resistance mechanisms?

Membrane proteins like Rv1401/MT1445 may contribute significantly to drug resistance through several mechanisms:

  • Direct resistance mechanisms:

    • Efflux pump function or regulation

    • Alteration of membrane permeability to antibiotics

    • Drug target modification or protection

    • Inactivation of drugs at the cell envelope

  • Research approaches linking Rv1401/MT1445 to resistance:

    • Transcriptomic analysis comparing susceptible and resistant strains

    • Proteomic profiling of membrane fractions during drug exposure

    • Heterologous expression studies in model organisms

    • Directed evolution experiments under drug selection

  • Membrane protein-specific considerations:

    • Role in maintaining membrane potential affecting drug uptake

    • Contribution to cell envelope remodeling under stress

    • Involvement in persister cell formation

  • Integration with clinical outcomes:

    • Analysis of clinical isolate sequence variations

    • Correlation between expression levels and treatment outcomes

    • Identification of resistance-associated mutations

  • Experimental validation approaches:

    • Generation of overexpression strains to assess MIC changes

    • Knockout/knockdown studies with susceptibility testing

    • Drug accumulation assays in various genetic backgrounds

Understanding how Rv1401/MT1445 contributes to intrinsic or acquired drug resistance could inform new therapeutic strategies that target resistance mechanisms or serve as companion diagnostics to predict treatment success.

What is the potential of Rv1401/MT1445 as a biomarker for tuberculosis diagnostics or disease progression?

Evaluating Rv1401/MT1445 as a potential biomarker involves several research considerations:

  • Expression profile assessment:

    • Transcriptomic data from clinical samples

    • Proteomic detection in patient specimens (sputum, serum, urine)

    • Comparison between active TB, latent infection, and cured cases

    • Expression patterns in different disease manifestations (pulmonary vs. extrapulmonary)

  • Immunological recognition:

    • Antibody responses in patient populations

    • T-cell epitope mapping

    • B-cell epitope accessibility analysis

    • Cross-reactivity with environmental mycobacteria

  • Diagnostic development pathways:

    • Direct detection methods:

      • PCR-based nucleic acid amplification

      • Mass spectrometry signatures

      • Aptamer-based detection platforms

    • Indirect detection methods:

      • ELISA for antibody responses

      • Antigen-specific T-cell assays

      • Immunochromatographic rapid tests

  • Biomarker validation criteria:

    • Sensitivity and specificity calculations

    • Receiver operating characteristic (ROC) curve analysis

    • Comparison with established biomarkers

    • Performance in difficult-to-diagnose populations

  • Clinical utility assessment:

    • Predictive value for treatment outcomes

    • Correlation with bacterial burden

    • Response to therapy monitoring potential

    • Cost-effectiveness analysis

The ideal evaluation would include a longitudinal cohort study tracking Rv1401/MT1445-related biomarkers through different disease stages and treatment phases, with correlation to microbiological and clinical outcomes.

What are the most promising future research directions for understanding Rv1401/MT1445 function?

The uncharacterized nature of Rv1401/MT1445 opens several promising research avenues:

  • Integrated multi-omics approaches:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Temporal profiling during infection and stress response

    • Single-cell analyses to capture population heterogeneity

    • Systems biology modeling to predict functional networks

  • Cutting-edge structural studies:

    • Cryo-EM studies in native-like membrane environments

    • X-ray free-electron laser (XFEL) crystallography

    • Integrative structural biology combining multiple data types

    • In-cell structural studies using emerging technologies

  • Advanced genetic manipulation:

    • CRISPR interference for temporal and spatial control

    • Multiplex genome editing to study functional redundancy

    • Synthetic biology approaches for functional reconstitution

    • Gain-of-function screens in heterologous hosts

  • Host-pathogen interaction focus:

    • Role in immune evasion mechanisms

    • Contribution to granuloma formation or maintenance

    • Interface with host cell membranes or receptors

    • Impact on phagosomal maturation or escape

  • Translational research priorities:

    • Druggability assessment using fragment-based approaches

    • Development as a diagnostic biomarker

    • Evaluation as a vaccine component

    • Structure-based inhibitor design if function is established

These research directions should be pursued in parallel, with data integration strategies to build a comprehensive understanding of Rv1401/MT1445's role in tuberculosis pathophysiology. Collaborative approaches combining expertise in structural biology, microbiology, immunology, and computational biology will likely yield the most significant advances.

How can researchers overcome the challenges in studying uncharacterized membrane proteins like Rv1401/MT1445?

Addressing the unique challenges of uncharacterized membrane proteins requires innovative strategies:

  • Technical innovations:

    • Nanobody development for stabilization and crystallization

    • Synthetic biology approaches with designer membranes

    • Cell-free expression systems optimized for membrane proteins

    • Advanced labeling techniques for dynamic studies

  • Collaborative frameworks:

    • Consortium approaches pooling diverse expertise

    • Open-source sharing of preliminary data and reagents

    • Standardized protocols for membrane protein work

    • Centralized facilities for specialized techniques

  • Computational advances:

    • Improved deep learning for function prediction

    • Molecular dynamics simulations in realistic membranes

    • Integrative modeling using sparse experimental data

    • Network-based function prediction

  • Experimental design strategies:

    • Parallel testing of multiple hypotheses

    • Unbiased phenotypic screens followed by targeted validation

    • Evolutionary approaches to identify critical functional elements

    • Comparative studies across mycobacterial species

  • Resource development priorities:

    • Comprehensive antibody toolkits

    • Validated expression and purification platforms

    • Mutant libraries with characterized phenotypes

    • Specialized compound libraries targeting membrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.