Recombinant Uncharacterized membrane protein Rv3760 (Rv3760)

What is Rv3760 and what organism is it found in?

Rv3760 is a membrane protein encoded in the Mycobacterium tuberculosis genome. It has been characterized as a cell division protein DivIC (FtsB) that plays a role in stabilizing FtsL against RasP cleavage . The protein consists of 100-117 amino acids (depending on the specific annotation) and is encoded by a 303 base pair coding sequence located at position 4205538-4205840 on the positive strand of the M. tuberculosis genome . In earlier annotations, it was identified as a "POSSIBLE CONSERVED MEMBRANE PROTEIN," but more recent research has clarified its functional role in cell division processes .

What is the amino acid sequence of Rv3760?

The complete amino acid sequence of full-length Rv3760 (1-117) is:
MTSNPSSSADQPLSGTTVPGSVPGKAPEEPPVKFTRAAAVWSALIVGFLILILLLIFIAQNTASAQFAFFGWRWSLPLGVAILLAAVGGGLITVFAGTARILQLRRAAKKTHAAALR

This sequence contains hydrophobic regions characteristic of membrane proteins, consistent with its cellular localization and function. The sequence information is essential for researchers designing experiments involving protein expression, structural analysis, and interaction studies.

What is the primary function of Rv3760 in Mycobacterium tuberculosis?

Rv3760 functions as cell division protein DivIC (FtsB) in M. tuberculosis, playing a critical role in bacterial cell division . Specifically, it stabilizes FtsL, another cell division protein, against cleavage by RasP protease . This stabilization is essential for proper septum formation during bacterial cell division. Additionally, research indicates that Rv3760 may be involved in growth on cholesterol , suggesting it might have multiple functions in M. tuberculosis metabolism and survival. The protein is predicted to be co-regulated with other genes in specific modules (bicluster_0176 and bicluster_0413), indicating its integration into broader cellular processes and regulatory networks .

How should recombinant Rv3760 be stored for optimal stability?

For optimal storage of recombinant Rv3760, the following protocol is recommended:

• Store lyophilized protein powder at -20°C/-80°C upon receipt

• For reconstitution, use deionized sterile water to reach a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

• Prepare working aliquots to avoid repeated freeze-thaw cycles, which can significantly damage protein integrity

• Store working aliquots at 4°C for short-term use (up to one week)

The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0 . Trehalose serves as a cryoprotectant and stabilizer for membrane proteins. Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity .

What expression systems are used for recombinant Rv3760 production?

E. coli is the predominantly used expression system for recombinant Rv3760 production . A typical production protocol involves:

• Cloning the Rv3760 gene into an expression vector with an appropriate tag (commonly His-tag)

• Transforming the construct into an E. coli expression strain optimized for membrane protein production

• Inducing protein expression under controlled conditions

• Harvesting cells and lysing them to extract the target protein

• Purifying the recombinant protein using affinity chromatography

The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification . When working with membrane proteins like Rv3760, selecting appropriate detergents for extraction and purification is critical to maintain protein structure and function. Expression conditions such as temperature, induction time, and media composition often require optimization to maximize yield while maintaining protein integrity.

How is the purity of recombinant Rv3760 determined?

The purity of recombinant Rv3760 is typically determined using SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis), with commercial preparations generally achieving greater than 90% purity . The methodology involves:

• Loading protein samples alongside molecular weight markers on an SDS-PAGE gel

• Running the gel at constant voltage until sufficient separation is achieved

• Staining with Coomassie Blue or silver stain to visualize protein bands

• Analyzing band intensity using densitometry software to quantify purity percentage

For structural or functional studies, researchers should conduct multiple orthogonal purity assessments to ensure sample quality and homogeneity.

How can researchers reconstitute lyophilized Rv3760 protein?

The reconstitution of lyophilized Rv3760 requires careful handling to maintain protein integrity. The recommended protocol is:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Allow complete dissolution before any further manipulation

• For long-term storage, add glycerol to 5-50% final concentration (50% is recommended)

• Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

• Store aliquots at -20°C/-80°C for long-term storage or at 4°C for up to one week

Since Rv3760 is a membrane protein, researchers might consider adding appropriate detergents during reconstitution to maintain solubility and native-like structure, especially if functional assays are planned. The choice of detergent should be optimized based on the specific experimental requirements.

What methods are used to study Rv3760's role in cell division?

To investigate Rv3760's role in cell division as a DivIC (FtsB) protein, researchers employ several methodological approaches:

• Genetic manipulation:

  • Creating knockout or depletion strains to observe morphological changes

  • Complementation studies to confirm phenotype specificity

  • Site-directed mutagenesis to identify critical functional residues

• Microscopy techniques:

  • Fluorescence microscopy with membrane stains to visualize septum formation

  • Time-lapse imaging to observe division dynamics in real-time

  • Super-resolution microscopy to precisely localize Rv3760 at the division site

• Protein interaction studies:

  • Co-immunoprecipitation to identify division complex components

  • Bacterial two-hybrid assays to map protein-protein interactions

  • Fluorescence resonance energy transfer (FRET) to confirm direct interactions

• Structural biology:

  • Membrane protein crystallography or cryo-EM to determine 3D structure

  • NMR studies to map interaction interfaces with FtsL and other partners

Understanding Rv3760's precise role in cell division could potentially identify new targets for antimycobacterial drug development, given the essential nature of this process for bacterial survival.

How does Rv3760 stabilize FtsL against RasP cleavage?

Investigating how Rv3760 stabilizes FtsL against RasP cleavage requires sophisticated experimental approaches:

• Mapping the protected regions:

  • Limited proteolysis experiments with and without Rv3760 present

  • Mass spectrometry to identify protected cleavage sites

  • Construction of truncated FtsL variants to determine minimal protected region

• Identifying the interaction mechanism:

  • Site-directed mutagenesis of both Rv3760 and FtsL to identify critical residues

  • Structural studies of the Rv3760-FtsL complex

  • Molecular dynamics simulations to model interaction dynamics

• RasP cleavage assays:

  • In vitro reconstitution of RasP cleavage of FtsL

  • Time-course experiments with varying Rv3760 concentrations

  • Western blotting to detect cleavage products

The mechanism likely involves Rv3760 binding to specific regions of FtsL that contain or are adjacent to RasP recognition sites, causing conformational changes that make these sites inaccessible to the protease. Understanding this mechanism could provide insights into regulating bacterial cell division and potentially identify novel antibiotic targets.

What are the implications of Rv3760's co-regulation with other genes?

Rv3760 is predicted to be co-regulated in specific gene modules (bicluster_0176 and bicluster_0413) with particular regulatory signatures . Investigating these co-regulation patterns requires:

• Functional enrichment analysis:

  • Conducting Gene Ontology enrichment of all genes in these biclusters

  • Identifying common biological processes or cellular components

• Regulatory motif analysis:

  • Examining the identified cis-regulatory motifs (e-values 0.08 and 1.60 for bicluster_0176; 0.12 and 0.15 for bicluster_0413)

  • Predicting transcription factors that might bind these motifs

• Expression correlation studies:

  • Performing qRT-PCR to validate co-expression under various conditions

  • Conducting RNA-seq analysis across multiple growth conditions

  • Creating co-expression networks to visualize relationships

This co-regulation suggests Rv3760 functions within broader cellular processes beyond cell division alone, potentially linking division with other aspects of mycobacterial physiology such as stress response or metabolism.

How can researchers investigate the role of Rv3760 in cholesterol metabolism?

Research indicates that Rv3760 may be involved in growth on cholesterol . To investigate this connection, researchers can implement:

• Growth and viability studies:

  • Culturing wild-type and Rv3760 mutant strains on media with cholesterol as the sole carbon source

  • Measuring growth rates and bacterial survival

  • Performing competition assays between wild-type and mutant strains

• Metabolomic approaches:

  • Using LC-MS/MS to profile cholesterol metabolites in wild-type vs. mutant strains

  • Conducting isotope-labeled cholesterol tracing experiments

  • Analyzing changes in lipid composition using lipidomics

• Transcriptomic and proteomic analyses:

  • Performing RNA-seq comparing expression profiles with/without cholesterol

  • Using quantitative proteomics to identify differentially expressed proteins

  • Applying systems biology approaches to identify affected metabolic pathways

• Biochemical assays:

  • Testing enzymatic activities related to cholesterol metabolism

  • Investigating potential direct interactions with cholesterol or its metabolites

This investigation would determine whether Rv3760 directly participates in cholesterol metabolism or if its role is indirect, perhaps through its effects on cell division or membrane organization.

What experimental approaches can resolve contradictory data regarding Rv3760 function?

When faced with contradictory data about Rv3760 function, researchers should implement a systematic approach:

• Critical evaluation of methodologies:

  • Comparing experimental conditions, strains, and techniques used in different studies

  • Assessing sensitivity, specificity, and limitations of each approach

  • Creating a standardized comparison table:

  Study	Methodology	Key Findings	Potential Confounding Factors
  Study A	Technique X	Finding 1	Limitation A
  Study B	Technique Y	Finding 2	Limitation B

• Replication studies:

  • Conducting side-by-side experiments using multiple strains and conditions

  • Implementing orthogonal techniques to validate key findings

  • Using standardized protocols to enable direct comparison

• Reconciliation through context:

  • Investigating strain-specific or condition-dependent effects

  • Exploring potential multifunctional aspects of Rv3760

  • Developing integrated models that explain apparent contradictions

• Data integration approaches:

  • Applying meta-analysis techniques to synthesize findings across studies

  • Developing computational models to reconcile divergent observations

  • Using systems biology approaches to place contradictory findings in broader context

This systematic approach can transform apparently contradictory data into a more nuanced understanding of Rv3760's context-dependent functions in M. tuberculosis.

What are the most effective techniques for studying Rv3760 membrane topology?

Determining the membrane topology of Rv3760 requires multiple complementary approaches:

• Computational prediction:

  • Using transmembrane prediction algorithms (TMHMM, Phobius, MEMSAT)

  • Applying topology prediction tools specific for bacterial membrane proteins

  • Performing hydropathy analysis to identify potential membrane-spanning regions

• Reporter fusion techniques:

  • Creating systematic fusions with reporter enzymes (alkaline phosphatase, β-galactosidase)

  • Analyzing activity patterns to map membrane-spanning segments

  • Determining cytoplasmic versus periplasmic localization of protein domains

• Cysteine accessibility methods:

  • Introducing single cysteine residues throughout the protein sequence

  • Treating intact cells with membrane-impermeable/permeable sulfhydryl reagents

  • Detecting labeling patterns to determine accessibility from different sides of the membrane

• Protease protection assays:

  • Treating membrane preparations with proteases

  • Analyzing protected fragments by mass spectrometry

  • Comparing results with right-side-out versus inside-out membrane vesicles

• Advanced structural techniques:

  • Solid-state NMR with isotopically labeled protein

  • Cryo-electron microscopy of 2D crystals or reconstituted protein

  • EPR spectroscopy with site-directed spin labeling

A comprehensive topology map would integrate data from multiple approaches and would inform structure-function relationship studies, particularly regarding how Rv3760 interacts with FtsL and other divisome components.