Recombinant Uncharacterized membrane protein Rv3835/MT3943 (Rv3835, MT3943)

What is the structural characterization of Rv3835/MT3943?

Rv3835/MT3943 is a conserved membrane protein consisting of 449 amino acids expressed in Mycobacterium tuberculosis H37Rv . The protein contains a signal peptide, suggesting it undergoes secretion processing . The amino acid sequence begins with MLDAPEQDPVDPGDPASPPHGEAEQPLPGPRWPRALRASATRRALLLTALGGLLIAGLVTAIPAVGRAPER and continues through the full 449 residues .

The protein is predicted to have transmembrane domains, consistent with its classification in the functional category of "Cell wall and cell processes" . Proteomic analyses have identified this protein in multiple cellular fractions, including cell membrane fractions and culture filtrates, suggesting it may have both membrane-integrated and secreted forms . Research approaches to further characterize its structure should include membrane topology mapping and potentially crystallography studies, though membrane proteins present significant challenges for the latter.

What are the known functional characteristics of Rv3835/MT3943?

Despite being classified as "uncharacterized," proteomic studies have provided valuable insights into potential functions of Rv3835/MT3943. The protein has been identified in:

• Culture filtrates of M. tuberculosis H37Rv, suggesting secretion capability

• The cell membrane fraction using 2DLC/MS techniques

• Triton X-114 extracts, confirming its membrane association

• M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days post-infection, suggesting a potential role in persistent infection

Functionally, it belongs to the cell wall and cell processes category, indicating potential involvement in cell envelope maintenance or cell division . While the specific biochemical functions remain undetermined, its consistent conservation across mycobacterial species suggests an important biological role . Interestingly, it appears to be non-essential for in vitro growth in rich medium, as determined by Himar1 transposon mutagenesis studies .

Transcriptomics analysis revealed that Rv3835 mRNA is down-regulated after 24h and 96h of starvation, suggesting a potential role in metabolic adaptation to nutrient-limited conditions .

What expression systems are recommended for Rv3835/MT3943?

• Vector selection: Use vectors with tunable promoters to control expression levels, as membrane protein overexpression can be toxic to host cells .

• Host strain consideration: Consider specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)) .

• Fusion partners: Employ fusion tags that can improve folding and stability, such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier), in addition to His-tags for purification .

• Expression conditions: Optimize by testing multiple temperatures (typically lower temperatures like 16-20°C slow protein folding and improve correct membrane insertion) .

• Screening approach: Utilize fluorescent size-exclusion chromatography and His-specific fluorescent probes to rapidly assess protein quality and yield .

The currently available recombinant form of Rv3835/MT3943 has been produced in E. coli with a His-tag, demonstrating the feasibility of this approach .

How is the genetic context of Rv3835 relevant to research studies?

The genetic neighborhood of Rv3835 provides important contextual information for functional studies. Rv3835 is located at genomic coordinates 4309047-4310396 in the positive orientation in M. tuberculosis H37Rv . STRING database analysis reveals strong predicted functional associations with several other mycobacterial proteins:

These protein interaction predictions suggest that Rv3835 may work in concert with other membrane and cell envelope proteins, particularly those involved in cell division or membrane organization . Researchers should consider studying these proteins collectively when investigating the function of Rv3835.

What experimental approaches can resolve the functional role of Rv3835/MT3943?

Resolving the function of this uncharacterized protein requires integrated multi-omics approaches:

• Gene knockout studies: Though Rv3835 has been characterized as non-essential for in vitro growth , differential phenotyping of knockout strains under various stress conditions (nutrient limitation, antibiotic challenge, pH stress, etc.) may reveal conditional essentiality.

• Proteomics interactions: Perform co-immunoprecipitation or bacterial two-hybrid assays to identify protein-protein interactions, focusing on the predicted partners identified in STRING database (Rv2164c, Rv3836, etc.) .

• Transcriptional response analysis: Evaluate the expression profile of Rv3835 under conditions mimicking in-host environments, building on the observation of its presence in guinea pig lungs at 90 days post-infection and down-regulation during starvation .

• Localization studies: Although proteomics has identified this protein in membrane fractions and culture filtrates , fluorescent protein fusions or immunogold electron microscopy could provide precise subcellular localization patterns during different growth phases.

• Comparative genomics: Analyze orthologous proteins in other mycobacterial species, particularly the equivalent ML0081 in Mycobacterium leprae which shows 69.35% identity .

• Structural biology approaches: Utilize approaches like cryo-EM rather than traditional crystallography, given the challenges of membrane protein structural determination .

Implementing these complementary approaches will provide convergent evidence of function while overcoming limitations inherent to any single experimental strategy.

How does Rv3835/MT3943 potentially contribute to M. tuberculosis pathogenesis?

Several lines of evidence suggest potential pathogenesis-related functions for Rv3835/MT3943:

• Temporal expression during infection: The identification of Rv3835 in M. tuberculosis-infected guinea pig lungs at 90 days but not 30 days post-infection suggests a potential role in persistent infection rather than initial colonization .

• Membrane localization: As a membrane protein, Rv3835 could participate in host-pathogen interactions, environmental sensing, or nutrient acquisition at the bacterial cell surface .

• Response to starvation: The down-regulation of Rv3835 mRNA during starvation conditions suggests involvement in metabolic adaptation, a critical aspect of M. tuberculosis persistence in granulomas .

• Conservation across mycobacterial species: The protein is described as "a core mycobacterial gene; conserved in mycobacterial strains" , indicating an important role in mycobacterial biology.

To experimentally assess the pathogenic role, researchers should consider:

• Infection models comparing wild-type and Rv3835-deficient strains

• Evaluation of bacterial survival in macrophages and within hypoxic or nutrient-limited environments

• Assessment of immunological responses to the protein

• Testing for altered drug susceptibility profiles in strains with modified Rv3835 expression

These studies would clarify whether Rv3835 contributes directly to virulence or supports pathogen adaptation to host environments.

What purification challenges are specific to Rv3835/MT3943?

Purifying membrane proteins like Rv3835/MT3943 presents several technical challenges that require specific methodological solutions:

• Solubilization optimization: Given its membrane localization, selecting appropriate detergents is critical. Start with a detergent screen including mild options (DDM, LMNG) and more stringent ones (SDS, Triton X-100), evaluating protein stability and function post-extraction .

• Protein stability maintenance: Membrane proteins often denature rapidly once removed from their lipid environment. Consider:

  • Adding lipids during purification

  • Using amphipols or nanodiscs for stabilization

  • Including glycerol (typically 10-20%) in buffers

  • Maintaining low temperatures throughout purification

• Aggregation prevention: Monitor aggregation using techniques like dynamic light scattering or size-exclusion chromatography. The reported fluorescent size-exclusion chromatography method is particularly valuable for rapid assessment .

• Yield optimization: Expression levels of membrane proteins are typically low. Scale up cultivation volumes and optimize induction conditions (IPTG concentration, temperature, duration) .

• Purity assessment: The currently available recombinant Rv3835/MT3943 is produced with a His-tag for affinity purification . Consider additional purification steps such as ion exchange chromatography to achieve high purity for structural or functional studies.

When working with purified Rv3835/MT3943, minimize freeze-thaw cycles and store working aliquots at 4°C for up to one week to maintain functionality .

How can protein-protein interaction studies of Rv3835/MT3943 be designed?

Based on the predicted functional partners identified in the STRING database , designing robust protein-protein interaction studies for Rv3835/MT3943 requires:

• In vivo crosslinking approaches:

  • Utilize formaldehyde or DSP (dithiobis[succinimidyl propionate]) crosslinking in living mycobacterial cells

  • Analyze complexes through immunoprecipitation followed by mass spectrometry

  • This approach preserves native membrane environments where Rv3835 functions

• Bacterial two-hybrid systems:

  • Adapt mycobacterial two-hybrid systems specifically designed for membrane proteins

  • Focus screening on predicted partners (Rv2164c, Rv3836, Rv2345, Rv3491, Rv2799)

  • Include controls to eliminate false positives common in membrane protein interaction studies

• Co-purification approaches:

  • Use differentially tagged protein pairs (His-tag for Rv3835 and another tag for potential partners)

  • Perform tandem affinity purification to increase specificity

  • Validate interactions through reciprocal pull-downs

• FRET-based interaction assays:

  • Engineer fluorescent protein fusions compatible with membrane protein topology

  • Measure interactions in living cells to capture dynamic changes

  • Use acceptor photobleaching techniques to quantify interaction strength

These methods should be implemented with specific attention to maintaining the membrane environment integrity during sample preparation, as membrane protein interactions are frequently destabilized by detergents used during purification.

What role might Rv3835/MT3943 play in drug resistance mechanisms?

While direct evidence linking Rv3835/MT3943 to drug resistance is limited in the provided search results, several aspects of this protein suggest potential involvement in antimicrobial resistance mechanisms:

• Membrane localization: As a membrane protein , Rv3835 could affect cell permeability or drug efflux. The findings that orphan regulator Rv3143 increases antibiotic sensitivity by regulating cell wall permeability demonstrates how membrane-associated proteins can influence drug resistance.

• Interaction with respiratory chain components: If Rv3835 interacts with components of energy metabolism like Rv3143 does with NuoD , it might influence processes affected by drugs targeting energy metabolism (e.g., bedaquiline).

• Presence during persistent infection: The detection of Rv3835 in guinea pig lungs at 90 days post-infection but not at 30 days suggests a role in persistent infection, which is associated with phenotypic drug tolerance.

To investigate potential roles in resistance, researchers should consider:

• Creating Rv3835 overexpression and knockout strains to test minimum inhibitory concentrations of various TB drugs

• Examining Rv3835 expression in clinical drug-resistant isolates

• Testing the effect of Rv3835 modulation on membrane permeability and drug accumulation

• Investigating potential interactions with known drug resistance determinants

This research direction could provide valuable insights into alternate drug resistance mechanisms beyond the well-characterized target mutations.