Recombinant Uncharacterized membrane protein SPy_0358/M5005_Spy0301 (SPy_0358, M5005_Spy0301)

Shipped with Ice Packs
In Stock

Description

Introduction to the Target Protein

The recombinant uncharacterized membrane protein SPy_0358 (also annotated as M5005_Spy0301) is a hypothetical or predicted protein from bacterial or archaeal systems. While no direct experimental data is available in the provided literature, insights can be drawn from general methodologies for studying uncharacterized membrane proteins. This review synthesizes broader research frameworks applicable to such proteins, emphasizing challenges in expression, solubility, and functional characterization.

Challenges in Characterizing Uncharacterized Membrane Proteins

Membrane proteins, particularly those from underexplored organisms, face unique hurdles in structural and functional studies:

ChallengeDescriptionRelevant Source
Low Expression/SolubilityPoor yields in heterologous systems (e.g., E. coli) due to aggregation or misfolding
Detergent SensitivityLoss of function or structure during solubilization with detergents like FC15
Lack of Functional DomainsAbsence of conserved motifs for bioinformatics prediction (e.g., β-barrels, helices)
Host Strain OptimizationNeed for strain engineering (e.g., E. coli ΔtolRA) to enhance membrane protein display

Recombinant Expression Systems

Key strategies include:

  • Engineered Fusions: Use of outer membrane protein F (OmpF) or autotransporters (e.g., Hbp) to direct secretion to bacterial membranes or outer membrane vesicles (OMVs) .

  • Host Selection: E. coli remains a primary host due to genetic tractability, but challenges with solubility necessitate novel detergents (e.g., FC15) or cold shock induction .

Hypothetical Workflow for SPy_0358 Characterization

Given the lack of direct data, a proposed experimental pipeline would involve:

  1. Bioinformatics Prediction:

    • Topology: Use tools like HMMTOP or Hunter to predict transmembrane domains .

    • Functional Motifs: Search for homology to known secretion systems (e.g., Type IX secretion) or lipid-binding domains (e.g., FYVE, RUN) .

  2. Recombinant Production:

    • Host Selection: Test E. coli BL21(DE3) or S. enterica ΔtolRA for membrane localization .

    • Solubilization: Screen detergents (e.g., FC15, foscholine) to maintain structural integrity .

  3. Functional Assays:

    • Binding Studies: Use OMVs or lipid bilayers to test interactions with lipids (e.g., phosphatidylinositol) .

    • Protein Ligation: Apply SpyTag/SpyCatcher for modular display on OMVs to study antigen presentation .

Critical Gaps and Future Directions

  • Structural Data: No high-resolution structures are available for SPy_0358, necessitating X-ray crystallography or cryo-EM.

  • Functional Annotation: Requires targeted mutagenesis or interaction studies with conserved partners (e.g., Rab GTPases, lipids).

  • Comparative Genomics: Cross-referencing with archaeal or bacterial orthologs (e.g., COG0392 flippases) may reveal conserved roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in your order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development for your order.
Synonyms
SPy_0358; M5005_Spy0301; Uncharacterized membrane protein SPy_0358/M5005_Spy0301
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M1
Target Names
SPy_0358
Target Protein Sequence
MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASSAARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND
Uniprot No.

Target Background

Database Links
Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant SPy_0358/M5005_Spy0301 typically prepared for research applications?

Recombinant SPy_0358/M5005_Spy0301 protein is commonly expressed in E. coli with an N-terminal His-tag to facilitate purification. The protein is typically prepared as follows:

  • Gene cloning into an expression vector with a T7 promoter system

  • Transformation into E. coli expression hosts, with Lemo21(DE3) strain often preferred for membrane proteins to allow tunable expression

  • Induction of protein expression under optimized conditions

  • Cell lysis and membrane fraction isolation

  • Solubilization using appropriate detergents

  • Purification via immobilized metal affinity chromatography (IMAC)

  • Quality assessment by SDS-PAGE to verify >90% purity

  • Lyophilization for storage in a Tris/PBS-based buffer with 6% trehalose at pH 8.0

For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What expression systems are most effective for producing functional SPy_0358/M5005_Spy0301?

The optimal expression system for SPy_0358/M5005_Spy0301 depends on research objectives:

Expression SystemAdvantagesDisadvantagesRecommended Use Cases
E. coli (Lemo21(DE3))Tunable expression, cost-effective, high yieldPotential misfolding, lacks some PTMsInitial characterization, structural studies
Mammalian cells (HEK293S)Better folding, native-like PTMsHigher cost, lower yieldFunctional studies, protein-protein interactions
Insect cellsCompromise between yield and foldingMore complex than E. coliWhen E. coli yields non-functional protein

How can I optimize the yield of properly folded SPy_0358 membrane protein?

Optimizing yield of properly folded SPy_0358 requires a factorial experimental approach to systematically test multiple variables:

  • Expression level regulation: In Lemo21(DE3), titrate L-rhamnose (0-2000 μM) to modulate T7 RNA polymerase inhibition, as lower expression often results in better membrane integration

  • Induction conditions: Test a matrix of:

    • Temperature (16°C, 25°C, 30°C)

    • IPTG concentration (0.1-1.0 mM)

    • Induction time (4h, 8h, overnight)

  • Growth media supplementation:

    • Add glycyl-betaine (2 mM) and sorbitol (1%) to stabilize membrane proteins

    • Include appropriate antibiotics for plasmid maintenance

  • Membrane extraction conditions:

    • Test multiple detergents (DDM, LDAO, C12E8) at various concentrations

    • Optimize solubilization time and temperature

A 2^3 factorial experimental design examining temperature, induction time, and IPTG concentration would require 8 experimental conditions to identify optimal parameters and potential interaction effects . For instance, the combination of low temperature (16°C) and extended induction time (overnight) often yields better results for membrane proteins by slowing expression and allowing proper membrane insertion .

What experimental methods are suitable for investigating the function of this uncharacterized membrane protein?

Since SPy_0358/M5005_Spy0301 is uncharacterized, a multi-faceted approach is required:

  • Bioinformatic analysis:

    • Homology modeling against known membrane protein structures

    • Evolutionary conservation analysis to identify functionally important residues

  • Localization studies:

    • Immunofluorescence microscopy to determine subcellular localization in S. pyogenes

    • Fractionation studies to confirm membrane association

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged protein

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation with potential interacting partners

  • Functional assays:

    • Gene knockout/complementation studies in S. pyogenes

    • Bacterial adhesion assays to human tonsillar epithelial cells

    • Virulence assessment in relevant infection models

  • Structural studies:

    • Circular dichroism to assess secondary structure

    • Crystallization trials or cryo-EM for tertiary structure

These approaches should be conducted systematically, starting with bioinformatic predictions to guide wet-lab experiments. Since S. pyogenes has specificity for palatine tonsil epithelium, adhesion assays using human tonsillar cells may be particularly informative .

How should I design experiments to investigate SPy_0358's potential role in streptococcal colonization of human tonsils?

A comprehensive experimental design would include:

  • Generate necessary tools:

    • Create isogenic deletion mutant (ΔSPy_0358) in S. pyogenes

    • Prepare complemented strain (ΔSPy_0358+pSPy_0358)

    • Produce purified recombinant protein for in vitro assays

  • Establish an ex vivo tonsillar colonization model:

    • Collect human palatine tonsil samples (with ethical approval)

    • Establish primary tonsillar epithelial cell cultures

    • Validate model using known colonization factors

  • Perform comparative colonization assays:

    • Wild-type vs. ΔSPy_0358 vs. complemented strain

    • Quantify adherence and invasion using colony counting

    • Visualize interactions by immunofluorescence microscopy

    • Assess gene expression changes in both bacteria and host cells

  • Validate with competitive index assays:

    • Co-infect with wild-type and mutant strains

    • Determine competitive index using qPCR or differentially marked strains

  • Investigate host-response:

    • Measure cytokine/chemokine production

    • Assess epithelial barrier integrity

    • Examine recruitment of immune cells in co-culture systems

The experimental protocol should be rigorously documented, including blinding procedures to avoid bias and appropriate statistical analysis methods. A factorial design can be used to assess interactions between bacterial factors and host variables .

What are the challenges in obtaining structural information for SPy_0358, and how can they be addressed?

Obtaining structural information for membrane proteins like SPy_0358 presents several challenges:

  • Protein expression and purification challenges:

    • Low expression levels

    • Protein aggregation and misfolding

    • Detergent selection affects protein stability

  • Crystallization difficulties:

    • Detergent micelles complicate crystal formation

    • Conformational heterogeneity

    • Limited hydrophilic surfaces for crystal contacts

  • NMR limitations:

    • Size limitations for solution NMR

    • Complex spectra due to detergent interference

Methodological solutions include:

  • Protein engineering approaches:

    • Creation of fusion constructs with crystallization chaperones

    • Targeted mutagenesis to enhance stability

    • Truncation constructs to remove disordered regions

  • Alternative structural methods:

    • Cryo-electron microscopy (less dependent on crystals)

    • Solid-state NMR for membrane-embedded proteins

    • Small-angle X-ray scattering for low-resolution envelopes

  • Lipidic cubic phase crystallization:

    • Provides native-like membrane environment

    • Facilitates crystal contacts through lipid matrix

  • Nanodiscs and amphipols:

    • Stabilize membrane proteins in water-soluble particles

    • Maintain native folding and function

Structural information for SPy_0358 would likely require a combination of approaches, starting with secondary structure characterization via circular dichroism, followed by crystallization trials in various detergent and lipid systems .

How can computational approaches complement experimental methods in studying SPy_0358 structure-function relationships?

Computational approaches can provide valuable insights when experimental structural data is limited:

  • Homology modeling:

    • Identify structural homologs using HHpred or Phyre2

    • Build models based on related membrane proteins

    • Validate models using energy minimization and Ramachandran analysis

  • Molecular dynamics simulations:

    • Simulate protein behavior in lipid bilayers

    • Assess stability of predicted structures

    • Identify potential binding sites and conformational changes

  • Evolutionary coupling analysis:

    • Detect co-evolving residues suggesting spatial proximity

    • Constrain structural models based on evolutionary data

    • Identify functionally important residue networks

  • Machine learning approaches:

    • Apply deep learning for structure prediction (AlphaFold2)

    • Predict transmembrane topology using neural networks

    • Identify potential functional motifs

  • Virtual screening:

    • Identify potential ligands or inhibitors

    • Predict binding sites and affinities

    • Guide experimental validation studies

The integration of computational predictions with limited experimental data can significantly accelerate structural characterization. For instance, AlphaFold2 predictions could be validated using targeted cysteine crosslinking experiments, providing constraints that refine the structural model .

How should I design a comprehensive research protocol for studying SPy_0358's role in Streptococcus pyogenes pathogenesis?

A well-designed research protocol for studying SPy_0358 should include:

  • Study Objectives and Hypotheses:

    • Clearly state the research question (e.g., "Does SPy_0358 contribute to S. pyogenes adherence to human tonsillar epithelium?")

    • Define specific, measurable hypotheses

    • Identify dependent and independent variables

  • Experimental Design:

    • Include controls (positive, negative, vehicle)

    • Define sample sizes with power analysis

    • Plan for biological and technical replicates

    • Implement randomization and blinding where appropriate

  • Methodological Details:

    • Bacterial strains and growth conditions

    • Cell culture methods and validation

    • Gene manipulation techniques

    • Protein expression and purification protocols

    • Functional assays with step-by-step procedures

    • Equipment specifications and calibration requirements

  • Data Collection and Analysis Plan:

    • Define primary and secondary outcomes

    • Specify statistical tests and significance thresholds

    • Plan for handling missing or outlier data

    • Describe image analysis methods if applicable

  • Ethical Considerations:

    • Biosafety procedures for handling S. pyogenes

    • Human subjects protection for tonsillar tissue samples

    • Data management and confidentiality protocols

  • Timeline and Resources:

    • Milestone schedule for project completion

    • Required resources and contingency plans

This protocol should be sufficiently detailed to allow other researchers to replicate the work, addressing potential biases and experimental limitations .

What safety precautions should be included in a laboratory protocol for working with recombinant SPy_0358 and S. pyogenes?

A comprehensive safety protocol should include:

  • Biosafety Level Considerations:

    • S. pyogenes requires BSL-2 containment

    • Work in certified biosafety cabinets

    • Use sealed centrifuge rotors or safety cups

  • Personal Protective Equipment:

    • Laboratory coat, gloves, eye protection

    • Face shield for procedures with splash risk

    • Change PPE when contaminated or moving between work areas

  • Waste Management:

    • Dedicated, labeled containers for biohazardous waste

    • Decontamination procedures (autoclave or chemical)

    • Sharps disposal in puncture-resistant containers

  • Decontamination Procedures:

    • Work surface disinfection (70% ethanol, 10% bleach)

    • Equipment decontamination before repair/maintenance

    • Spill response protocols with appropriate disinfectants

  • Emergency Procedures:

    • Exposure response protocols (needle sticks, splashes)

    • Reporting procedures for incidents

    • Location of emergency equipment (eyewash, shower)

  • Training Requirements:

    • Documentation of biosafety training

    • Pathogen-specific hazard awareness

    • Standard operating procedures review

  • Specific S. pyogenes Precautions:

    • Prevention of aerosol generation

    • No mouth pipetting

    • Handwashing protocols before leaving laboratory

These safety measures should be implemented alongside institutional guidelines and regularly reviewed to ensure compliance with current best practices .

How can factorial experimental design be applied to optimize multiple parameters affecting SPy_0358 expression and function?

Factorial experimental design offers a powerful approach for optimizing SPy_0358 research:

  • Principle of factorial design: This approach allows simultaneous investigation of multiple factors and their interactions, reducing the total number of experiments needed compared to one-factor-at-a-time approaches.

  • Application to SPy_0358 expression optimization:

    A 2³ factorial design examining three key factors in membrane protein expression might look like:

    RunTemperature (A)IPTG Concentration (B)Induction Time (C)SPy_0358 Yield (mg/L)
    1Low (16°C)Low (0.1mM)Short (4h)45
    2High (30°C)Low (0.1mM)Short (4h)71
    3Low (16°C)High (1.0mM)Short (4h)48
    4High (30°C)High (1.0mM)Short (4h)65
    5Low (16°C)Low (0.1mM)Long (16h)68
    6High (30°C)Low (0.1mM)Long (16h)60
    7Low (16°C)High (1.0mM)Long (16h)80
    8High (30°C)High (1.0mM)Long (16h)65
  • Analysis of factorial results:

    • Calculate main effects of each factor

    • Identify interaction effects between factors

    • Generate response surface models

    • Validate optimal conditions with confirmation runs

  • Example findings: This hypothetical data might reveal that the combination of low temperature and high IPTG with long induction time produces the highest yield (Run 7), but interaction analysis could show that temperature effects depend on induction time.

This approach can also be applied to functional assays, such as optimizing binding conditions or identifying critical environmental factors affecting SPy_0358 activity .

What advanced analytical techniques can be applied to investigate protein-lipid interactions involving SPy_0358?

Understanding SPy_0358 interactions with membrane lipids requires sophisticated analytical approaches:

  • Lipid binding assays:

    • Liposome flotation assays to assess membrane association

    • Surface plasmon resonance with immobilized lipid bilayers

    • Microscale thermophoresis to measure binding affinities

  • Structural analyses of protein-lipid interactions:

    • Hydrogen-deuterium exchange mass spectrometry to identify lipid-binding regions

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Solid-state NMR to determine orientation in membranes

  • Functional impact of lipid environment:

    • Reconstitution in nanodiscs with defined lipid composition

    • Activity assays in various lipid environments

    • Fluorescence spectroscopy to monitor conformational changes

  • Native mass spectrometry:

    • Identification of specifically bound lipids

    • Determining stoichiometry of protein-lipid complexes

    • Analysis of how lipids affect oligomerization

  • Computational approaches:

    • Molecular dynamics simulations in mixed lipid bilayers

    • Prediction of lipid binding sites

    • Free energy calculations for lipid-protein interactions

These techniques can reveal how the membrane environment modulates SPy_0358 structure and function, potentially uncovering lipid-dependent regulatory mechanisms relevant to S. pyogenes pathogenesis .

How should I analyze and interpret seemingly contradictory results in SPy_0358 functional studies?

Contradictory results in membrane protein research are common due to the complexity of these systems. A systematic approach to resolving such contradictions includes:

  • Methodological assessment:

    • Compare experimental conditions (buffers, detergents, pH, temperature)

    • Evaluate protein preparation methods (tags, constructs, purification)

    • Assess assay sensitivity and specificity

    • Check for interference from experimental components

  • Biological explanations:

    • Consider conformational heterogeneity or multiple functional states

    • Evaluate potential post-translational modifications

    • Assess oligomerization state differences

    • Examine host cell or strain-specific effects

  • Statistical re-evaluation:

    • Perform meta-analysis if multiple datasets exist

    • Check for outliers and their influence

    • Evaluate statistical power and effect sizes

    • Consider Bayesian approaches to integrate prior knowledge

  • Reconciliation strategies:

    • Design critical experiments to directly test contradictions

    • Develop unifying models that explain apparent contradictions

    • Use orthogonal techniques to validate key findings

    • Consult with experts in specific methodologies

  • Reporting recommendations:

    • Transparently acknowledge contradictions

    • Discuss potential explanations

    • Propose future experiments to resolve issues

    • Consider pre-registering follow-up studies

Remember that apparent contradictions often lead to deeper understanding of complex biological systems. For example, differing results in adhesion assays might reveal that SPy_0358 functions differently under aerobic versus anaerobic conditions, reflecting its biological role during different stages of infection .

What statistical approaches are most appropriate for analyzing complex datasets from SPy_0358 research?

Complex datasets from membrane protein research require sophisticated statistical approaches:

  • Multivariate analysis techniques:

    • Principal Component Analysis (PCA) for dimensionality reduction

    • Cluster analysis to identify patterns in large datasets

    • Factor analysis to uncover latent variables

    • MANOVA for simultaneously analyzing multiple dependent variables

  • Mixed-effects models:

    • Account for both fixed effects (experimental conditions) and random effects (biological variation)

    • Handle repeated measures and nested designs

    • Appropriate for longitudinal studies of protein activity

  • Bayesian statistical approaches:

    • Incorporate prior knowledge about membrane proteins

    • Handle small sample sizes better than frequentist methods

    • Allow for probability statements about hypotheses

    • Facilitate hierarchical modeling of complex biological systems

  • Machine learning methods:

    • Support Vector Machines for classification problems

    • Random Forests for identifying important predictors

    • Neural networks for pattern recognition in complex datasets

    • Cross-validation to assess model generalizability

  • Specialized methods for specific data types:

    • Survival analysis for time-to-event data

    • Circular statistics for analysis of protein structural data

    • Network analysis for protein-protein interaction data

    • Spatial statistics for localization studies

When reporting results, include effect sizes alongside p-values, visualize data appropriately, and provide access to raw data and analysis code to ensure reproducibility .

How can I establish effective cross-disciplinary collaborations to advance SPy_0358 research?

Effective cross-disciplinary collaboration on membrane protein research requires strategic planning:

  • Identifying complementary expertise:

    • Structural biologists for protein characterization

    • Microbiologists for pathogen biology

    • Immunologists for host-pathogen interactions

    • Bioinformaticians for sequence and structural analysis

    • Medicinal chemists for inhibitor development

  • Establishing a shared conceptual framework:

    • Create a common language across disciplines

    • Develop shared research questions

    • Align methodological approaches

    • Define success metrics meaningful to all parties

  • Research platform integration:

    • Utilize enterprise research platforms that facilitate data sharing

    • Implement common data standards and formats

    • Establish protocols for technology transfer between labs

    • Create secure environments for sensitive data

  • Collaborative project management:

    • Clear definition of roles and responsibilities

    • Regular communication schedules

    • Milestone-based progress tracking

    • Authorship and intellectual property agreements

  • Funding considerations:

    • Target interdisciplinary funding mechanisms

    • Combine resources from multiple funding sources

    • Leverage institutional support for collaborative initiatives

    • Consider industry partnerships for translational aspects

The SAS analytical research platform offers tools to orchestrate the entire research lifecycle and integrate data from academic, government, and industry sources, which can be particularly valuable for complex membrane protein projects involving multiple stakeholders .

What are the best practices for sharing SPy_0358 research data and resources with the scientific community?

Effective data sharing enhances reproducibility and accelerates scientific progress:

  • Data repository selection:

    • Use established repositories appropriate for data type:

      • Protein Data Bank (PDB) for structural data

      • GenBank for sequence data

      • Proteomics data repositories (PRIDE, MassIVE)

      • Figshare or Zenodo for datasets without specific repositories

  • Data standardization:

    • Follow community standards (MIAME, STRENDA, etc.)

    • Provide comprehensive metadata

    • Use controlled vocabularies and ontologies

    • Include detailed methods for data generation

  • Resource sharing:

    • Deposit plasmids in repositories (Addgene)

    • Share cell lines through established repositories

    • Provide detailed protocols (protocols.io)

    • Make analysis code available (GitHub)

  • Open access publishing:

    • Preprint servers for early sharing (bioRxiv)

    • Open access journals or repositories

    • Supplementary data inclusion

    • Publication of negative results

  • Data management planning:

    • Create a data management plan before starting research

    • Consider privacy and ethical constraints

    • Plan for long-term data preservation

    • Address intellectual property considerations

  • Collaborative tools:

    • Electronic lab notebooks for documentation

    • Project management software for tracking

    • Version control for data and code

    • Virtual research environments for remote collaboration

These practices facilitate the transparent exchange of information necessary for advancing understanding of complex membrane proteins like SPy_0358 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.