Recombinant Uncharacterized membrane protein spyM18_0408 (spyM18_0408)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncharacterized Membrane Protein spyM18_0408 (spyM18_0408)

Recombinant Uncharacterized Membrane Protein spyM18_0408 (spyM18_0408) is a bacterial membrane-associated protein of unknown function, derived from Streptococcus pyogenes serotype M3. It belongs to the BAX inhibitor (BI)-1/YccA family, a group of proteins implicated in stress response and apoptosis regulation across prokaryotic and eukaryotic systems . As a "hypothetical" protein, its precise biological role remains uncharacterized, though its recombinant expression enables structural and functional studies.

3.1. Classification and Domains

  • KEGG Annotation: Classified under spyM18_0408, linked to uncharacterized membrane protein families .

  • COG Category: Likely falls under COG5572 (DUF2282 family), which includes conserved bacterial membrane proteins of unknown function .

3.2. Research Applications

  • Antibody Development: Used to generate polyclonal antibodies for detecting native spyM18_0408 in S. pyogenes .

  • Pathogenicity Studies: Potential role in bacterial virulence inferred from homology to BI-1/YccA proteins, which modulate stress responses .

Challenges in Recombinant Expression

Membrane proteins like spyM18_0408 face inherent production hurdles:

ChallengeSolution Applied
Low solubilityUse of detergent-containing buffers .
Toxicity to host cellsOptimized induction in E. coli .
Post-translational modificationsYeast or mammalian systems for glycosylation .

5.1. Experimental Observations

  • Affinity Purification: Successfully isolated via AviTag-biotinylation in E. coli systems .

  • Cross-Reactivity: Antisera show broad reactivity with Streptococcus species, suggesting conserved epitopes .

5.2. Unresolved Questions

  • No in vitro functional data (e.g., enzymatic activity, ligand binding) is available.

  • Structural studies (e.g., cryo-EM) are pending to resolve transmembrane topology.

Comparative Analysis with Related Proteins

ProteinOrganismFunctionExpression System
AcrZE. coliMultidrug efflux pump componentE. coli
BI-1/YccAChlamydiaApoptosis regulationE. coli
spyM18_0408S. pyogenesUnknownYeast, E. coli

Future Directions

  1. Functional Characterization: High-throughput screening for binding partners or enzymatic activity.

  2. Structural Elucidation: Cryo-EM or X-ray crystallography to resolve 3D architecture.

  3. In Vivo Studies: Knockout models to assess role in bacterial pathogenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary based on your purchase method and location. We recommend contacting your local distributor for specific delivery estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
spyM18_0408; Uncharacterized membrane protein spyM18_0408
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M18 (strain MGAS8232)
Target Names
spyM18_0408
Target Protein Sequence
MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND
Uniprot No.

Target Background

Database Links
Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural information available for spyM18_0408?

spyM18_0408 is an uncharacterized membrane protein from Streptococcus pyogenes serotype M18 consisting of 229 amino acids . Current structural data remains limited, but initial characterization suggests it belongs to the bacterial membrane protein family with potential roles in cellular processes that are yet to be fully elucidated.

To begin structural characterization, researchers should consider:

  • Primary sequence analysis using tools like BLAST, Pfam, and TMHMM

  • Secondary structure prediction through circular dichroism spectroscopy

  • Transmembrane domain prediction using computational algorithms

  • Homology modeling based on related characterized membrane proteins

What expression systems are most effective for recombinant production of spyM18_0408?

Expression SystemAdvantagesLimitationsRecommended for spyM18_0408
E. coliHigh yield, cost-effective, rapid growthMay form inclusion bodies, potential improper foldingInitial expression screening
Yeast systemsBetter for eukaryotic-like folding, post-translational modificationsLonger growth time, complex media requirementsSecondary screening if E. coli fails
Insect cellsSuperior folding for complex proteinsHigher cost, technical complexityAdvanced characterization studies
Cell-free systemsAvoids toxicity issues, direct membrane incorporationLower yields, higher costDifficult-to-express variants

For optimal results, implement the following methodology:

  • Test multiple strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta)

  • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Screen various detergents for solubilization (DDM, LDAO, OG)

  • Consider fusion partners (MBP, SUMO) to enhance solubility

How can I verify the purity and integrity of recombinant spyM18_0408?

Quality assessment should employ multiple complementary techniques:

  • SDS-PAGE analysis under reducing conditions (expect band at ~25-30 kDa considering His-tag contribution)

  • Western blot using anti-His antibodies

  • Size exclusion chromatography to assess oligomeric state and homogeneity

  • Mass spectrometry for molecular weight confirmation and post-translational modifications

  • Dynamic light scattering for assessing aggregation state

When working with membrane proteins like spyM18_0408, it's critical to maintain protein stability throughout purification. Consider similarity to the workflow shown for other membrane proteins, where SDS-PAGE under reducing and non-reducing conditions helps confirm protein integrity .

What are the recommended approaches for functional characterization of uncharacterized membrane proteins like spyM18_0408?

Characterizing uncharacterized membrane proteins requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Identify conserved domains through multiple sequence alignments

    • Perform phylogenetic analysis with characterized homologs

    • Utilize protein-protein interaction prediction algorithms

  • Gene knockout/complementation studies:

    • Generate S. pyogenes knockouts using CRISPR-Cas9 or allelic exchange

    • Assess phenotypic changes in growth, morphology, and virulence

    • Complement with wild-type and mutant variants to confirm function

  • Localization studies:

    • Use GFP fusion constructs to determine subcellular localization

    • Perform immunofluorescence with specific antibodies

    • Validate with subcellular fractionation followed by Western blotting

  • Interaction studies:

    • Employ bacterial two-hybrid systems

    • Perform co-immunoprecipitation with potential binding partners

    • Use crosslinking followed by mass spectrometry to identify interactors

For experimental design, follow robust scientific principles to ensure reliable results, as poor design can lead to confounding variables and irreproducible findings .

What experimental design considerations are critical when studying protein-protein interactions involving spyM18_0408?

When investigating protein-protein interactions for membrane proteins like spyM18_0408, consider these methodological approaches:

  • Control selection:

    • Include positive controls (known interacting proteins)

    • Incorporate negative controls (unrelated membrane proteins)

    • Use empty vector controls for expression systems

  • Validation through multiple techniques:

    • Begin with in silico prediction of interaction partners

    • Confirm with at least two orthogonal methods (e.g., bacterial two-hybrid and co-IP)

    • Quantify interaction strength through biophysical methods (SPR, ITC)

  • Membrane environment considerations:

    • Maintain native-like lipid environment when possible

    • Test interactions in detergent micelles, nanodiscs, and liposomes

    • Consider the impact of different detergents on interaction stability

  • Replication and statistical analysis:

    • Perform at least three biological replicates

    • Apply appropriate statistical tests (t-test, ANOVA)

    • Report effect sizes along with p-values

How can I effectively design experiments to determine the membrane topology of spyM18_0408?

Determining membrane topology requires combining computational prediction with experimental validation:

  • Computational prediction methods:

    • TMHMM, Phobius, and TOPCONS for transmembrane domain prediction

    • SignalP for signal peptide identification

    • PSIPRED for secondary structure elements

  • Experimental validation approaches:

    • Cysteine scanning mutagenesis with membrane-impermeable thiol reagents

    • Protease protection assays with proteases of varying specificities

    • Insertion of reporter domains (PhoA, GFP) at various positions

    • Site-directed antibody labeling of epitope tags

  • Data integration strategy:

    • Create a consensus topology model from multiple prediction tools

    • Systematically test critical regions experimentally

    • Refine model iteratively based on experimental results

A methodical approach combining these techniques will generate a reliable topology model that informs further functional studies.

How can researchers address the challenge of limited sequence homology when predicting functions of spyM18_0408?

When dealing with proteins of limited sequence homology like spyM18_0408, traditional homology-based function prediction may be insufficient. Instead:

  • Structure-based function prediction:

    • Utilize threading approaches (I-TASSER, Phyre2)

    • Identify structural motifs that suggest function despite sequence divergence

    • Look for conserved binding sites or catalytic residues

  • Genomic context analysis:

    • Examine operonic structure and gene neighborhood

    • Identify co-evolved genes through phylogenetic profiling

    • Analyze expression patterns during different growth conditions

  • Integrated approaches:

    • Combine weak signals from multiple prediction methods

    • Weight predictions based on confidence scores

    • Develop targeted experiments to test specific functional hypotheses

  • Machine learning approaches:

    • Apply deep learning algorithms trained on known membrane protein functions

    • Use feature extraction based on physicochemical properties

    • Incorporate evolutionary information through position-specific scoring matrices

This multi-faceted approach maximizes the likelihood of generating testable hypotheses about protein function even when sequence homology is limited.

What strategies can help overcome expression and purification challenges for spyM18_0408?

Membrane proteins like spyM18_0408 present significant expression and purification challenges. Implement these methodological approaches:

  • Expression optimization matrix:

VariableOptions to testAssessment method
Expression vectorpET, pBAD, pMALWestern blot, activity assay
Promoter strengthT7, tac, araBADYield quantification
Fusion tagsHis, MBP, SUMO, TrxSolubility comparison
Growth mediaLB, TB, M9, auto-inductionBiomass and protein yield
Induction temperature37°C, 30°C, 25°C, 18°CSoluble fraction analysis
Induction time3h, 6h, overnightTime-course sampling
  • Solubilization screening:

    • Test detergent panel (DDM, LDAO, OG, CHAPS)

    • Evaluate novel solubilization agents (SMALPs, amphipols)

    • Consider nanodiscs for native-like environment

  • Purification optimization:

    • Implement two-step purification (IMAC followed by size exclusion)

    • Monitor protein stability using thermal shift assays

    • Validate function at each purification step

  • Quality control checkpoints:

    • Assess homogeneity by dynamic light scattering

    • Confirm secondary structure by circular dichroism

    • Verify proper folding through ligand binding assays

This systematic approach addresses the common bottlenecks in membrane protein expression and purification, increasing the likelihood of obtaining functional protein for downstream analyses.

How can I analyze contradictory results in spyM18_0408 interaction studies?

When facing contradictory results in protein interaction studies, implement this analytical framework:

  • Methodological variations assessment:

    • Compare experimental conditions (buffer composition, pH, salt concentration)

    • Evaluate protein constructs used (full-length vs. truncated, tag position)

    • Examine detection methods (direct vs. indirect, sensitivity thresholds)

  • Critical analysis flowchart:

    • Identify consistent vs. inconsistent observations across methods

    • Weigh evidence based on methodological rigor and controls

    • Develop experiments specifically designed to resolve contradictions

  • Biological context considerations:

    • Assess if contradictions reflect condition-dependent interactions

    • Consider post-translational modifications affecting interactions

    • Evaluate potential methodological artifacts vs. true biological variations

  • Resolution strategies:

    • Design definitive experiments with orthogonal methods

    • Use quantitative approaches to determine binding affinities

    • Implement mutagenesis studies targeting interaction interfaces

This framework enables systematic resolution of contradictory results and advances understanding of protein-protein interactions involving spyM18_0408.

What are the best techniques for studying the structure-function relationship of spyM18_0408?

Investigating structure-function relationships for membrane proteins requires an integrated approach:

  • High-resolution structural analysis:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly successful for membrane proteins)

    • NMR spectroscopy (suitable for smaller domains or fragments)

    • Molecular dynamics simulations to model behavior in membrane environment

  • Functional characterization methods:

    • Site-directed mutagenesis targeting conserved residues

    • Chimeric protein construction with characterized homologs

    • Truncation analysis to identify functional domains

    • Electrophysiology for channel or transporter functions

  • Structure-guided experimental design:

    • Focus mutations on predicted functional sites

    • Design constructs based on domain boundaries

    • Develop binding assays for predicted interaction surfaces

  • Data integration strategy:

    • Correlate structural features with functional outcomes

    • Map conservation patterns onto structural models

    • Identify structural changes upon ligand binding or environmental changes

This comprehensive approach enables researchers to establish causative links between structural elements and functional properties of spyM18_0408.

How should researchers design control experiments when studying spyM18_0408?

Control experiments are critical for reliable research on uncharacterized proteins:

  • Negative controls:

    • Empty vector expressions

    • Irrelevant membrane proteins of similar size

    • Scrambled or inactivated binding partners

    • Heat-denatured protein preparations

  • Positive controls:

    • Well-characterized membrane proteins with similar properties

    • Known binding partners for interaction studies

    • Established protocols applied to well-studied proteins

  • Experimental validation controls:

    • Technical replicates to assess method precision

    • Biological replicates to capture natural variation

    • Dose-response relationships to confirm specificity

    • Controls for each experimental condition and variable

  • Statistical considerations:

    • Power analysis to determine appropriate sample size

    • Randomization to minimize bias

    • Blinding during analysis when possible

    • Appropriate statistical tests with correction for multiple comparisons

Implementing robust controls prevents misinterpretation of results and enhances reproducibility, particularly important when working with uncharacterized proteins like spyM18_0408 .

What are the recommended protocols for cross-linking studies to identify interaction partners of spyM18_0408?

Cross-linking mass spectrometry (XL-MS) offers powerful insights into protein interactions:

  • Cross-linker selection:

    • Use membrane-permeable cross-linkers for in vivo studies (DSS, formaldehyde)

    • Apply photo-activatable cross-linkers for specific interactions (Sulfo-SBED)

    • Consider cross-linker arm length to capture different interaction distances

    • Test multiple cross-linkers with varied chemistry for comprehensive coverage

  • Reaction optimization:

    • Establish concentration-dependent cross-linking efficiency

    • Optimize reaction time to minimize non-specific interactions

    • Perform in native membrane environment when possible

    • Control temperature and pH for consistent results

  • Sample processing workflow:

    • Enrich cross-linked complexes using affinity purification

    • Perform proteolytic digestion with multiple enzymes

    • Fractionate samples to reduce complexity

    • Apply targeted enrichment of cross-linked peptides

  • Data analysis strategy:

    • Use specialized software for cross-link identification (pLink, xQuest)

    • Apply stringent filtering criteria to minimize false positives

    • Validate high-confidence interactions through orthogonal methods

    • Map interaction sites onto structural models

This methodical approach enables identification of physiologically relevant interaction partners and provides insight into the spatial organization of protein complexes involving spyM18_0408.

What emerging technologies should researchers consider for studying membrane proteins like spyM18_0408?

Several cutting-edge technologies offer new opportunities for membrane protein research:

  • Advanced structural biology approaches:

    • Cryo-electron tomography for in situ visualization

    • Micro-electron diffraction (MicroED) for small crystals

    • Integrative structural biology combining multiple data sources

    • AlphaFold2 and other AI-based structure prediction tools

  • Functional genomics technologies:

    • CRISPR-Cas9 screening for functional networks

    • Transposon sequencing to identify genetic interactions

    • Single-cell transcriptomics to capture expression heterogeneity

    • Ribosome profiling for translational regulation analysis

  • Advanced imaging methods:

    • Super-resolution microscopy for subcellular localization

    • Single-molecule tracking for dynamic behavior

    • Correlative light and electron microscopy

    • Expansion microscopy for enhanced resolution

  • Novel expression systems:

    • Cell-free expression systems with defined membrane mimetics

    • Engineered minimal cells for membrane protein production

    • Synthetic biology approaches for functional reconstitution

    • Nanopore-based functional assays

Incorporating these emerging technologies can overcome traditional bottlenecks in membrane protein research and provide unprecedented insights into the structure and function of proteins like spyM18_0408.

How can computational approaches advance our understanding of spyM18_0408 function?

Computational methods offer powerful complements to experimental approaches:

  • Advanced modeling techniques:

    • Molecular dynamics simulations in explicit membrane environments

    • Coarse-grained simulations for larger systems and longer timescales

    • QM/MM approaches for potential enzymatic functions

    • Machine learning prediction of functional sites

  • Network-based analyses:

    • Protein-protein interaction network integration

    • Metabolic pathway modeling

    • Gene regulatory network analysis

    • Cross-species functional annotation transfer

  • Evolutionary analysis methods:

    • Ancestral sequence reconstruction

    • Evolutionary rate analysis for functional inference

    • Coevolution detection for interaction partners

    • Positive selection analysis for host-pathogen interfaces

  • Integration with experimental data:

    • Computational design of targeted mutations

    • In silico screening for potential ligands

    • Model refinement using sparse experimental constraints

    • Multi-scale modeling connecting molecular to cellular scales

These computational approaches can generate testable hypotheses about spyM18_0408 function and guide efficient experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.