Recombinant Uncharacterized membrane protein SpyM3_0260 (SpyM3_0260)

Shipped with Ice Packs
In Stock

Description

Production & Purification

The recombinant protein is produced through E. coli-based cell-free expression systems, achieving ≥85% purity via SDS-PAGE . Key production details:

Optimized Parameters

  • Storage: Tris-based buffer with 50% glycerol at -20°C (short-term) or -80°C (long-term)

  • Handling: Working aliquots stable at 4°C for ≤7 days

  • Yield: Available in 0.02 mg to 5×0.1 mg quantities, with pricing from $1,690 to $12,440 USD

Functional Implications

Putative Roles Based on Homology

  • BAX/YccA Family: Potential involvement in apoptosis regulation or membrane stress responses

  • Streptococcal Pathogenesis: Conserved domains suggest possible roles in:

    • Host cell adhesion

    • Immune evasion

    • Membrane transport processes

Comparative Analysis

ProteinOrganismFunctional Clues
SpyM3_0260S. pyogenes M3Unknown
M6_Spy0327S. pyogenes M6Membrane organization
spyM18_0408S. pyogenes M18Stress response

Research Applications

Current Uses

  • Antigen candidate for streptococcal serotyping

  • Control protein in membrane protein extraction studies

  • Template for developing BI-1/YccA family inhibitors

Validation Data

  • Immunoreactivity confirmed by western blot using infected swine sera (parallel validation method from )

  • Lot-to-lot consistency demonstrated through SDS-PAGE and functional assays (methodology adapted from )

Challenges & Future Directions

Key Knowledge Gaps

  • Three-dimensional structure

  • Specific interacting partners

  • Role in streptococcal virulence

Emerging Characterization Strategies

  1. Native MS + DMT for intact mass analysis

  2. MAAH-FAIMS-LC-EThcD workflows for disulfide mapping

  3. Cryo-EM with XL-MS validation (as used for SERINC3)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
SpyM3_0260; Uncharacterized membrane protein SpyM3_0260
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Target Names
SpyM3_0260
Target Protein Sequence
MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND
Uniprot No.

Target Background

Database Links
Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SpyM3_0260 and what organism does it originate from?

SpyM3_0260 is an uncharacterized membrane protein derived from Streptococcus pyogenes serotype M3, a gram-positive bacterial pathogen. The protein is identified in the UniProt database with the accession number P0DA10. Currently, its physiological function remains largely unknown, making it a target for basic research investigations focused on bacterial membrane proteins . When working with this protein, researchers should consider its membrane-associated nature, which influences experimental design and handling protocols.

What expression systems are available for producing recombinant SpyM3_0260?

Multiple expression systems have been developed for the production of recombinant SpyM3_0260, each with specific advantages depending on your research requirements. Available systems include:

  • Bacterial (E. coli) expression - Product code CSB-EP317886SMV1

  • Yeast expression - Product code CSB-YP317886SMV1

  • Baculovirus-infected insect cells - Product code CSB-BP317886SMV1

  • Mammalian cell expression - Product code CSB-MP317886SMV1

The selection of an appropriate expression system should be guided by experimental objectives. For structural studies requiring post-translational modifications, eukaryotic systems (mammalian or insect cells) are preferable, while E. coli systems may be suitable for preliminary functional assays or when large protein quantities are needed.

What is the expected purity and formulation of recombinant SpyM3_0260?

Commercial preparations of recombinant SpyM3_0260 typically have a purity exceeding 85% as determined by SDS-PAGE analysis . The protein is generally supplied as a lyophilized powder, which requires reconstitution before experimental use. For optimal results, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability during storage, addition of 5-50% glycerol (final concentration) is recommended . Researchers should verify protein integrity via SDS-PAGE or Western blot prior to downstream applications.

How does the partial length of recombinant SpyM3_0260 affect experimental interpretations?

The commercially available recombinant SpyM3_0260 is a partial-length protein, which presents both advantages and limitations for research applications . This partial structure may exclude certain domains or functional regions of the native protein, potentially affecting:

  • Protein folding and tertiary structure

  • Membrane insertion capabilities

  • Interaction profiles with potential binding partners

  • Enzymatic or signaling activities

When designing experiments with partial-length proteins, researchers must carefully consider which regions are present and absent. For comprehensive functional studies, it may be necessary to compare results using different constructs containing various domains. Structural prediction tools can help identify which functional motifs are preserved in the partial construct, guiding appropriate experimental design and interpretation of results.

What approaches are recommended for studying membrane protein topology of SpyM3_0260?

As an uncharacterized membrane protein, determining the topology of SpyM3_0260 is crucial for understanding its function. Several complementary approaches are recommended:

  • Computational prediction: Tools such as TMHMM, MEMSAT, and Phobius can predict transmembrane domains and their orientation.

  • Protease protection assays: By expressing SpyM3_0260 in membrane vesicles and subjecting them to proteases, researchers can determine which regions are protected (intracellular/lumenal) versus exposed (extracellular).

  • Cysteine scanning mutagenesis: Introducing cysteine residues at different positions and assessing their accessibility to membrane-impermeable labeling reagents.

  • Fusion protein reporters: Creating fusions with reporters like GFP or alkaline phosphatase at different positions can reveal membrane topology based on reporter activity.

  • Cryo-electron microscopy: For high-resolution structural analysis, particularly if the protein can be purified with its native conformation intact .

Researchers should employ multiple approaches simultaneously, as each method has inherent limitations, particularly when working with uncharacterized proteins.

How can biotinylated versions of SpyM3_0260 enhance protein-protein interaction studies?

The Avi-tag biotinylated version of SpyM3_0260 (CSB-EP317886SMV1-B) offers significant advantages for protein-protein interaction investigations . This recombinant protein is biotinylated in vivo using AviTag-BirA technology, where BirA catalyzes the formation of an amide linkage between biotin and a specific lysine residue in the AviTag sequence.

Methodological applications include:

  • Pull-down assays: The exceptionally strong biotin-streptavidin interaction (Kd ≈ 10^-15 M) allows for highly efficient isolation of SpyM3_0260 along with its binding partners.

  • Surface plasmon resonance (SPR): Biotinylated SpyM3_0260 can be immobilized on streptavidin-coated sensor chips for real-time binding kinetics analysis.

  • Protein microarrays: The oriented immobilization ensures functional epitopes remain accessible, improving the sensitivity and specificity of array-based interaction studies.

  • Microscopy applications: When coupled with fluorescent streptavidin conjugates, biotinylated SpyM3_0260 can be used to visualize protein localization and interactions in cellular contexts.

This approach has advantages over traditional tagging methods as it allows for controlled, oriented immobilization that minimizes steric hindrance and preserves protein functionality .

What strategies should be employed for initial functional characterization of SpyM3_0260?

For an uncharacterized membrane protein like SpyM3_0260, a systematic approach to functional characterization is essential:

  • Sequence-based prediction: Begin with bioinformatic analysis using tools like BLAST, Pfam, and InterPro to identify conserved domains, motifs, or homology to proteins of known function.

  • Structural prediction: Employ AI-based structure prediction tools (e.g., AlphaFold2) to generate structural models that may provide functional insights based on structural similarity to characterized proteins .

  • Expression profiling: Analyze under which conditions the native protein is expressed in S. pyogenes, which may provide clues about its physiological role.

  • Deletion/overexpression phenotyping: Generate knockout or overexpression strains in S. pyogenes to observe resulting phenotypes, particularly related to:

    • Membrane integrity

    • Antibiotic resistance

    • Stress response

    • Virulence in infection models

  • Protein interactome mapping: Identify binding partners through approaches such as:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid screening

    • Proximity labeling techniques

  • Lipid interaction studies: Assess binding preferences to different lipids using techniques like lipid overlay assays or liposome flotation assays, which may indicate functional membrane microdomains.

Data from these complementary approaches should be integrated to develop testable hypotheses about specific functions for targeted validation experiments.

How should experimental controls be designed when working with SpyM3_0260?

Robust control design is particularly important when studying uncharacterized proteins:

  • Negative controls:

    • Empty vector or irrelevant protein expressed in the same system

    • Heat-denatured SpyM3_0260 to distinguish specific from non-specific effects

    • Scrambled peptide sequences for interaction studies

  • Positive controls:

    • Well-characterized membrane proteins from the same family (if known)

    • Known binding partners of related proteins

    • Established assays for similar membrane protein functions (transport, signaling, etc.)

  • System controls:

    • Expression of SpyM3_0260 in multiple systems to distinguish host-specific artifacts

    • Comparison of tagged versus untagged versions to assess tag interference

    • Concentration gradients to establish dose-dependent effects

  • Technical validation:

    • Multiple detection methods for key findings (e.g., different antibodies or detection systems)

    • Biological replicates from independent protein preparations

    • Orthogonal assays measuring the same phenomenon via different mechanisms

For each experiment, controls should be tailored to address specific potential artifacts or alternative explanations for observed phenomena .

How can bioinformatic approaches aid in functional prediction of SpyM3_0260?

Given the uncharacterized nature of SpyM3_0260, bioinformatic analyses provide crucial starting points for functional investigation:

  • Homology-based approaches:

    • BLAST searches against characterized proteins to identify functional homologs

    • Multiple sequence alignments to identify conserved residues indicative of functional sites

    • Phylogenetic analysis to understand evolutionary relationships and potential functional conservation

  • Structure-based prediction:

    • Protein threading to detect structural similarity to proteins of known function

    • Binding pocket identification and characterization

    • Molecular dynamics simulations to assess conformational flexibility and potential binding sites

  • Genomic context analysis:

    • Examination of neighboring genes in the S. pyogenes genome (operonic structure)

    • Comparative genomics across bacterial species to identify conserved genomic arrangements

    • Analysis of co-expression patterns with genes of known function

  • Network-based approaches:

    • Protein-protein interaction network predictions

    • Functional association networks from resources like STRING database

    • Gene ontology enrichment analysis of predicted interactors

  • Specialized membrane protein tools:

    • Transmembrane topology prediction (TMHMM, MEMSAT)

    • Signal peptide prediction (SignalP)

    • Lipid modification prediction (PrePS, GPS-Lipid)

Researchers should integrate results from multiple tools and approaches, looking for consensus predictions while remaining aware of the limitations of each method .

How should contradictory experimental results about SpyM3_0260 be reconciled?

When working with uncharacterized proteins like SpyM3_0260, contradictory results are common due to limited prior knowledge. A systematic approach to resolving such contradictions includes:

  • Methodological assessment:

    • Evaluate whether different experimental systems (expression hosts, tags, buffers) might explain discrepancies

    • Consider whether partial versus full-length constructs produce different results

    • Assess whether membrane environment differences influence protein behavior

  • Condition-dependent functionality:

    • Test whether the protein exhibits different functions under different conditions (pH, temperature, ionic strength)

    • Consider allosteric regulation or conformational changes that might explain apparently contradictory functions

    • Investigate potential post-translational modifications affecting activity

  • Statistical rigor:

    • Increase sample sizes to improve statistical power

    • Apply appropriate statistical tests for the data type and distribution

    • Consider Bayesian approaches to integrate prior knowledge with new data

  • Collaborative verification:

    • Engage multiple laboratories to independently test key findings

    • Employ orthogonal techniques to verify results

    • Design decisive experiments specifically aimed at resolving contradictions

  • Literature comparison:

    • Examine whether related proteins show similar context-dependent behaviors

    • Look for precedents of multifunctional proteins with seemingly contradictory activities

    • Consider whether the contradictions reflect actual biological complexity rather than experimental artifacts

The scientific process often advances through the resolution of contradictory findings, particularly with novel proteins where initial characterization may reveal unexpected complexity .

How can solubility and stability issues with recombinant SpyM3_0260 be addressed?

Membrane proteins like SpyM3_0260 frequently present solubility and stability challenges. Researchers can implement several strategies to overcome these issues:

  • Optimizing solubilization conditions:

    • Screen different detergents (non-ionic, zwitterionic, ionic) at various concentrations

    • Test detergent mixtures which often perform better than single detergents

    • Evaluate detergent-lipid mixed micelles or nanodiscs for maintaining native-like environment

    • Consider amphipols or styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Buffer optimization:

    • Systematically vary pH, ionic strength, and salt composition

    • Include stabilizing additives such as glycerol (5-50%), specific lipids, or cholesterol

    • Test the addition of specific ligands or binding partners that may stabilize the protein

  • Construct engineering:

    • Remove flexible regions that may promote aggregation

    • Consider fusion partners known to enhance membrane protein solubility (e.g., SUMO, MBP)

    • Design truncations that preserve key domains while removing problematic regions

    • Introduce stability-enhancing mutations based on computational prediction

  • Storage considerations:

    • Determine optimal protein concentration to prevent concentration-dependent aggregation

    • Evaluate different storage temperatures (-80°C, -20°C, 4°C)

    • Test flash-freezing in liquid nitrogen versus slow freezing

    • Consider lyophilization with appropriate cryoprotectants

  • Quality control measures:

    • Implement size-exclusion chromatography to monitor oligomeric state and aggregation

    • Use circular dichroism to assess secondary structure integrity over time

    • Apply differential scanning fluorimetry to identify stabilizing conditions

    • Regularly check activity/binding to ensure functional integrity is maintained

Maintaining detailed records of conditions tested and outcomes observed is essential for developing optimal handling protocols for this challenging protein class .

What approaches can help troubleshoot expression problems with SpyM3_0260?

Expression of membrane proteins like SpyM3_0260 can be challenging across different host systems. When troubleshooting expression issues:

  • E. coli expression optimization:

    • Test different strains specialized for membrane proteins (C41/C43, Lemo21)

    • Evaluate various promoters for controlled expression rates (T7, tac, araBAD)

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Co-express with chaperones to aid proper folding

    • Consider fusion to MBP, SUMO, or other solubility-enhancing tags

  • Yeast expression strategies:

    • Compare different yeast species (S. cerevisiae, P. pastoris)

    • Test constitutive versus inducible promoters

    • Optimize media composition and growth temperature

    • Evaluate different signal sequences for proper membrane targeting

  • Insect cell expression:

    • Compare different insect cell lines (Sf9, Sf21, High Five)

    • Optimize virus-to-cell ratio and expression time

    • Test various viral promoters for expression timing and level

    • Evaluate co-expression with chaperones or auxiliary proteins

  • Mammalian expression approaches:

    • Compare transient versus stable expression systems

    • Test different cell lines (HEK293, CHO, COS-7)

    • Optimize transfection methods and conditions

    • Consider inducible expression systems for toxic proteins

  • Cell-free expression systems:

    • When cellular expression fails, consider E. coli, wheat germ, or insect cell extract-based cell-free systems

    • Supplement with lipids or detergents to facilitate membrane protein folding

    • Optimize reaction components and conditions for membrane protein synthesis

  • Codon optimization:

    • Adapt the coding sequence to the codon bias of the expression host

    • Remove rare codons, especially those occurring in clusters

    • Optimize GC content and RNA secondary structures

Each expression system has distinct advantages for different types of membrane proteins, and systematic comparison is often necessary to identify the optimal system for SpyM3_0260 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.