Recombinant Uncharacterized membrane protein ycf78 (ycf78)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ycf78; ycf1; Uncharacterized membrane protein ycf78; ycf1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Prototheca wickerhamii
Target Names
ycf78
Target Protein Sequence
MSLSTHIRDYVEVLTGVTEASGNPLQLAKLISESLLYVLKICQSEVLQILSFQWIRNFSL LPIKIPAIYESIIGQTPPEALFDFVEVLHLGQNPVIAGFLNSAFFALPFSAIHFVSIRRL LTQGVPAAIYSFGGYIIGQILFMSCVIFGVQDIIIPWLTLEPLNYIAGLILLSRIIISMR FESLAELETWDHPKYKNYFIYRFLIAWCEQGSIFQFLSNITPSANPTILQGFAFNNLGLN LVQNFSYIGGLLLGSAAFTLFWMWLFLKIQTYILVHTLYYHHQIVATVNQICFLSALTLS FATLPYYAYNYLLVGPLGFVPEDNALLSTVFTHSYLKDGPKELSFLTEEPIMELKLFPFN KGQYLIFPELYQTLSLEELSYRADYAWVRRVEKFSLDVTATHVGGRKLARRLGFHKLRQS FAKLILPRQTLAMDYRLELNSKYKCEDHDADIKAILDSELTNTRKESSIRGRRYRGDLSY DPTLDRFYQWYDFENVSLESSDQMMNYVTRTSVQGRFLFPQSFIKKEINLGEIHHEIGLR IKQQYNQSLIFRTLLKVDISFLLARQPKKHHLSGDQECDLQIKRNI
Uniprot No.

Target Background

Protein Families
Ycf78 family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What experimental approaches can be used to determine the subcellular localization of ycf78?

Determining subcellular localization of membrane proteins like ycf78 requires complementary techniques:

Approach 1: Indirect Immunofluorescence Microscopy

  • Generate monoclonal antibodies against purified ycf78 or specific peptides

  • Fix and permeabilize cells expressing ycf78

  • Label with anti-ycf78 primary antibody and fluorophore-conjugated secondary antibody

  • Co-stain with established organelle markers:

    • Plasma membrane: Na+/K+-ATPase

    • ER membrane: Calnexin

    • Golgi membrane: GM130

    • Mitochondria: TOM20

Based on studies with related membrane proteins, this approach effectively demonstrated plasma membrane localization of the Ycf1 protein throughout its life cycle .

Approach 2: Live Cell Imaging with Fluorescent Protein Fusions

  • Generate C-terminal and N-terminal GFP/mCherry fusions of ycf78

  • Express in appropriate cell lines

  • Perform confocal microscopy with z-stack acquisition

  • Co-express with organelle markers for colocalization analysis

Approach 3: Biochemical Fractionation

  • Perform subcellular fractionation to isolate membrane compartments

  • Prepare nuclear, mitochondrial, ER, Golgi, and plasma membrane fractions

  • Analyze each fraction by Western blot with anti-ycf78 antibodies

  • Include fraction-specific marker proteins as controls

Approach 4: APEX2 Proximity Labeling

  • Generate ycf78-APEX2 fusion construct

  • Express in cells and incubate with biotin-phenol and H₂O₂

  • Visualize biotinylated proteins with streptavidin-fluorophore

  • Identify precise subcellular location with nanometer resolution

Studies with related membrane proteins demonstrated that combining multiple approaches provides the most reliable localization data, as demonstrated for the Ycf1 protein in N. bombycis .

  • How can RNA interference be used to study the function of ycf78?

RNA interference (RNAi) provides a powerful approach to investigate ycf78 function:

siRNA design considerations:

  • Design 3-4 siRNAs targeting different regions of ycf78 mRNA

  • Target criteria:

    • 19-23 nucleotides in length

    • 30-60% GC content

    • Avoid regions with homology to other genes

    • Target regions 50-100 nt downstream of start codon

  • Include non-targeting control siRNAs

  • Consider positive control siRNAs targeting housekeeping genes

Experimental protocol:

  • Transfection optimization:

    • Test multiple transfection reagents (lipofection, electroporation)

    • Optimize cell density (typically 60-80% confluence)

    • Determine optimal siRNA concentration (10-50 nM)

    • Use fluorescently labeled control siRNA to assess transfection efficiency

  • Knockdown verification:

    • Measure ycf78 mRNA levels by qRT-PCR at 24h, 48h, 72h, and 96h post-transfection

    • Use gene-specific primers and appropriate reference genes (e.g., β-tubulin)

    • Confirm protein reduction by Western blot if antibody is available

  • Phenotypic analysis:

    • Assess cellular effects of ycf78 knockdown

    • Measure growth rate, morphology, and specific pathway activities

    • Quantify any observed phenotypes with appropriate statistical analysis

Based on research with related proteins, RNAi effectively downregulated Ycf1 gene expression, with significant effects observed at 24h, 72h, and 96h post-transfection . Knockdown of Ycf1 significantly reduced proliferation, suggesting an essential role in the organism's life cycle .

Data analysis example:
For qPCR analysis of knockdown efficiency, calculate relative expression using the 2^(-ΔΔCt) method:

Time PointControl (2^(-ΔCt))RNAi (2^(-ΔCt))Fold Changep-value
24h1.00 ± 0.120.45 ± 0.08-2.22<0.05
48h1.58 ± 0.210.93 ± 0.14-1.70<0.05
72h2.35 ± 0.250.85 ± 0.10-2.76<0.01
96h1.90 ± 0.180.62 ± 0.07-3.06<0.01
  • What are the challenges in crystallizing recombinant ycf78 for structural studies, and how can they be addressed?

Crystallizing membrane proteins like ycf78 presents specific challenges requiring systematic approaches:

Challenge 1: Detergent micelle heterogeneity

  • Solution: Screen multiple detergents systematically

    • Traditional detergents: DDM, DM, OG, LDAO

    • Novel detergents: MNG, GNG, LMNG

    • Facial amphiphiles and peptide surfactants

  • Implementation: Use fluorescence-based thermal shift assays to identify most stabilizing detergents

Challenge 2: Conformational heterogeneity

  • Solution: Stabilize specific conformations

    • Introduce disulfide bonds based on structure prediction

    • Co-crystallize with antibody fragments or nanobodies

    • Identify potential binding partners or substrates

  • Implementation: Engineer thermostabilized variants through alanine scanning

Challenge 3: Crystal contacts

  • Solution: Increase polar surface area

    • Remove flexible regions predicted from FSEC or limited proteolysis

    • Create fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

    • Engineer surface mutations to promote crystal contacts

  • Implementation: Use targeted surface entropy reduction (SER)

Crystallization methodology for ycf78:

  • Lipidic cubic phase (LCP) approach:

    • Mix protein (10-15 mg/ml) with monoolein at 2:3 protein:lipid ratio

    • Dispense 50-100 nl LCP bolus overlaid with 1 μl precipitant

    • Incubate at 20°C

    • Screen various precipitants, PEGs, and additives

  • Alternative methods if crystallization fails:

    • Cryo-electron microscopy (cryo-EM): Particularly effective for membrane proteins >100 kDa

    • Single-particle analysis can achieve 3-4 Å resolution

    • Example success: The structure of related Ycf1p was determined by cryo-EM, revealing its TMD0 domain and regulatory regions

Case study from related protein:
The structure of Ycf1p, a yeast membrane protein with similarity to ycf78, was successfully determined by cryo-EM. This structure revealed critical transmembrane domain architecture and regulatory regions, providing a potential structural template for understanding ycf78 .

  • What experimental design strategies can help resolve contradictory data regarding ycf78 function?

Resolving contradictions in ycf78 functional data requires robust experimental design:

Strategy 1: Systematic isolation of variables

  • Test specific hypotheses by manipulating one variable at a time

  • Create a factorial design matrix:

    • Expression system (bacterial, yeast, mammalian)

    • Buffer conditions (pH, ionic strength)

    • Temperature conditions

    • Presence/absence of potential binding partners

Strategy 2: Statistical power calculation

  • Determine appropriate sample size based on expected effect size

  • Example calculation for detecting a 25% difference with 80% power:

Effect SizeStandard DeviationRequired Sample Size (n per group)
25%20%10
25%30%22
25%40%37

Approach 1: Affinity purification coupled with mass spectrometry (AP-MS)

  • Express tagged ycf78 (FLAG, HA, or Strep-tag)

  • Solubilize membranes with mild detergents (digitonin, DDM)

  • Perform pull-down with tag-specific antibodies or resins

  • Identify co-purifying proteins by LC-MS/MS

  • Filter results against controls to remove common contaminants

Approach 2: Proximity-dependent labeling

  • BioID approach:

    • Create ycf78-BioID fusion protein

    • Express in cells for 24h with biotin supplementation

    • Isolate biotinylated proteins with streptavidin

    • Identify by mass spectrometry

  • TurboID or miniTurbo variants provide faster labeling kinetics

Approach 3: Split-ubiquitin membrane yeast two-hybrid

  • Specifically designed for membrane protein interactions

  • Create bait construct with ycf78 fused to C-terminal ubiquitin fragment (Cub) and transcription factor

  • Screen against prey library fused to N-terminal ubiquitin fragment (Nub)

  • Interaction reconstitutes ubiquitin, releasing transcription factor

  • Activation of reporter genes identifies interaction partners

Approach 4: Genetic interaction mapping

  • Particularly effective for functional characterization

  • Create double mutants of ycf78 with genes of interest

  • Measure phenotypic effect (growth, marker expression)

  • Identify synthetic lethal or suppressor interactions

Case study from related proteins:
Studies with the related membrane protein Erd1 employed a dosage suppressor screen to identify genes that, when overexpressed, could compensate for Erd1 function. This approach revealed interactions with proteins involved in membrane trafficking (Gyp1, Cog5, Cog7, Ypt7), providing functional insights . Similar approaches may be valuable for ycf78 characterization.

  • What controls are essential for flow cytometry experiments involving recombinant ycf78?

Proper controls are critical for reliable flow cytometry data with membrane proteins like ycf78:

Essential control 1: Single stain controls

  • Required for accurate compensation in multicolor experiments

  • Must be run every time, not reused from previous experiments

  • Include both:

    • Antibody-stained beads for uniform signal

    • Antibody-stained cells for biological context

  • Common error: Using single stain controls from different days leads to compensation errors

Essential control 2: Fluorescence Minus One (FMO) controls

  • Include all fluorophores except the one being measured

  • Superior to isotype controls for determining positive populations

  • Accounts for spectral spreading from multiple fluorophores

  • Required for each fluorophore in complex panels

Essential control 3: Unstained controls

  • Measure autofluorescence of cells

  • Establish baseline for fluorescence detection

  • Critical for distinguishing low-level expression from background

Essential control 4: Expression validation controls

  • Positive control: Cells expressing verified ycf78

  • Negative control: Non-transfected cells

  • Transfection control: Cells expressing irrelevant membrane protein

Essential control 5: Viability discrimination

  • Include viability dye to exclude dead cells

  • Dead cells bind antibodies non-specifically

  • Critical for membrane proteins that may affect cell viability

Common pitfalls to avoid:

  • Using compensation matrices from previous experiments

  • Relying only on beads for compensation without cellular controls

  • Using isotype controls instead of FMOs

  • Having unlabeled parameters in multicolor panels

Implementing these controls systematically ensures reliable detection and quantification of ycf78 in flow cytometry experiments.

  • How should researchers approach structure-function studies of uncharacterized membrane proteins like ycf78?

Structure-function analysis of uncharacterized membrane proteins requires a systematic approach:

Stage 1: In silico analysis and hypothesis generation

  • Perform sequence alignment with characterized homologs

  • Use homology modeling based on related structures (e.g., Ycf1p )

  • Identify conserved residues and motifs

  • Predict transmembrane topology and functional domains

  • Generate testable hypotheses about critical residues

Stage 2: Targeted mutagenesis

  • Design mutation panels targeting:

    • Conserved residues in predicted functional domains

    • Predicted transmembrane regions

    • Phosphorylation sites (ycf78 has 36 predicted sites )

    • Glycosylation sites (ycf78 has 1 predicted O-glycosylation site )

  • Create alanine-scanning libraries across regions of interest

  • Generate charge-swap mutations (E→K, K→E) to test electrostatic interactions

Stage 3: Functional characterization of mutants

  • Expression and localization analysis:

    • Assess membrane targeting of mutants

    • Quantify expression levels by Western blot

    • Visualize localization by microscopy

  • Biochemical characterization:

    • Thermal stability assays (DSF/nanoDSF)

    • Limited proteolysis susceptibility

    • Oligomerization state analysis

Stage 4: Detailed functional assays based on predicted function

  • If transport function is predicted:

    • Liposome reconstitution with fluorescent substrates

    • Electrophysiology in reconstituted systems

    • Vesicle transport assays

  • If signaling function is predicted:

    • Phosphorylation status analysis

    • Interaction partner binding assays

    • Downstream pathway activation

Case study approach:
The structure of related protein Ycf1p revealed that it belongs to ATP binding cassette (ABC) proteins involved in active transport across membranes . By mapping disease-causing mutations from human homologs onto the structure, researchers gained insights into the functional importance of specific domains . A similar approach could be valuable for ycf78, even before its structure is determined.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.