Recombinant Uncharacterized membrane protein yhhN (yhhN)

Shipped with Ice Packs
In Stock

Description

Membrane Topology

Detailed sequence analysis indicates that yhhN proteins possess eight transmembrane helices with an N-in/C-in topology . This architectural arrangement positions both the amino-terminal and carboxy-terminal regions on the cytoplasmic side of the membrane, creating a structural foundation that allows the protein to interact effectively with membrane-associated lipid substrates like lysoplasmalogens.

Conserved Functional Elements

The yhhN protein family contains approximately five highly conserved amino acid residues that likely form the catalytic active site . These evolutionarily preserved residues are strategically positioned to facilitate the protein's enzymatic activity in cleaving vinyl ether bonds in lysoplasmalogen substrates. The conservation of these residues across diverse species suggests their critical importance to the protein's function.

Physical Properties

When produced as a recombinant protein, yhhN is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . For research applications, the protein requires specific handling protocols, including reconstitution in deionized water to a concentration of 0.1-1.0 mg/mL and storage in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

Catalytic Activity

The most significant discovery regarding yhhN function emerged from research on the L. pneumophila homolog, which demonstrated robust lysoplasmalogenase activity . This enzymatic function involves the selective hydrolysis of the vinyl-ether bond in lysoplasmalogen, a type of lysophospholipid derived from membrane plasmalogens.

Kinetic Parameters

Experimental determination of the kinetic properties of LpYhhN has revealed the following parameters:

ParameterValue
Maximum velocity (Vmax)12
Michaelis constant (Km)45 μM
pH optimum6.5-7.0

These kinetic parameters are remarkably similar to those of mammalian TMEM86B, suggesting evolutionary conservation of function across different phylogenetic domains .

Substrate Specificity Profile

LpYhhN exhibits highly selective substrate preferences, demonstrating a specialized enzymatic role:

SubstrateActivity Level
LysoplasmalogenHigh
Diradyl plasmalogenNone
1-alkenyl-glycerolNone
Monoacylglycerophospho-ethanolamineNone
Monoacylglycerophospho-cholineNone

This distinct substrate specificity profile indicates that yhhN has evolved for the specific processing of lysoplasmalogen rather than functioning as a general lipid-metabolizing enzyme .

Taxonomic Prevalence

The YhhN protein family exhibits remarkable evolutionary conservation, being present in approximately:

  • 138 species of eukaryotes

  • 1205 species of bacteria, including numerous human pathogens

This widespread distribution across diverse organisms suggests that these proteins serve fundamental biological functions that have been preserved throughout evolution.

Bacterial yhhN Variants

A particularly intriguing aspect of yhhN biology is that many bacteria encoding YhhN family proteins, such as L. pneumophila, do not synthesize endogenous plasmalogens . This observation has led researchers to hypothesize that in these organisms, yhhN may serve a protective function against host-derived lipids during infection rather than participating in endogenous lipid metabolism.

Mammalian Homologs

In humans and other mammals, the homologs of yhhN are designated as TMEM86A and TMEM86B. The TMEM86B protein has been definitively identified as a lysoplasmalogenase in rat liver microsomes , demonstrating functional conservation between bacterial and mammalian versions of this protein family despite considerable evolutionary distance.

Role in Bacterial Pathogens

The presence of yhhN in numerous pathogenic bacteria, including the respiratory pathogen L. pneumophila, suggests potential roles in host-pathogen interactions. In L. pneumophila specifically, yhhN may protect the bacterium from lysis by lysoplasmalogens derived from host cell membranes during infection . This protective function could represent an important mechanism for bacterial survival within host cells.

Potential Therapeutic Implications

Given the potential role of yhhN in bacterial pathogenesis and survival, this protein represents a promising target for antimicrobial research. The identification of lysophosphatidic acid as a competitive inhibitor provides a foundation for the development of more potent and selective inhibitors that could potentially disrupt bacterial infection processes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yhhN; Z4842; ECs4317; Uncharacterized membrane protein YhhN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yhhN
Target Protein Sequence
MLWSFIAVCLSAWLSVDASYRGPTWQRWVFKPLTLLLLLLLAWQAPMFDAISYLVLAGLC ASLLGDALTLLPRQRLMYAIGAFFLSHLLYTIYFASQMTLSFFWPLPLVLLVLGALLLAI IWTRLEEYRWPICTFIGMTLVMVWLAGELWFFRPTAPALSAFVGASLLFISNFVWLGSHY RRRFRADNAIAAACYFAGHFLIVRSLYL
Uniprot No.

Target Background

Database Links

KEGG: ece:Z4842

STRING: 155864.Z4842

Protein Families
TMEM86 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are recommended for recombinant membrane proteins like yhhN?

    For uncharacterized bacterial membrane proteins like yhhN, E. coli-based expression systems remain the most widely used and effective. Specialized strains such as BL21 Gold (DE3) with deletions of abundant outer membrane proteins (OMPs) have demonstrated superior expression capabilities for various membrane proteins. The quadruple deletion strain (BL21ΔABCF) lacking OmpA, OmpC, OmpF, and LamB has shown significantly improved expression yields and better quality of produced proteins compared to standard strains .

    These specialized deletion strains address several challenges inherent to membrane protein expression:

    • Reduced competition for membrane insertion machinery

    • More membrane "space" available for recombinant protein

    • Less congestion of the BAM complex during insertion

    • Lower levels of envelope stress response activation

  • What are the main challenges in expressing recombinant membrane proteins?

    Expression of membrane proteins like yhhN faces multiple technical challenges:

    • Membrane insertion bottlenecks: During overexpression, the Sec and BAM machineries may become congested, resulting in inefficient membrane integration

    • Envelope stress response: Overexpression can trigger stress responses leading to protease induction, particularly DegP, which degrades misfolded proteins

    • Competition with endogenous membrane proteins: Abundant native OMPs compete for insertion machinery and membrane space

    • Protein misfolding: Without sufficient chaperone capacity, membrane proteins may misfold or aggregate

    • Energy requirements: Proper folding and insertion of β-barrel proteins relies on the folding energy of the β-barrel itself, as the periplasm lacks ATP and cannot maintain ionic gradients across the outer membrane

  • How do I determine if my recombinant membrane protein is correctly folded and inserted?

    Multiple complementary approaches can assess proper membrane insertion:

    • Membrane fractionation: Isolation of outer membrane fractions followed by SDS-PAGE analysis to confirm localization

    • Western blotting: Detection of full-length protein using specific antibodies or antibodies against affinity tags

    • Whole-cell ELISA: Quantitative assessment of surface-exposed epitopes, which confirms proper membrane insertion and correct orientation

    • Heat modifiability: Many properly folded β-barrel proteins show characteristic migration patterns on SDS-PAGE before and after heat denaturation

    • Functional assays: If the protein's function is known or can be predicted based on homology

  • What growth conditions should be optimized for membrane protein expression?

    Based on successful expression of various test membrane proteins in deletion mutant strains, the following growth conditions are recommended as a starting point for yhhN expression:

    • Growth temperature: 30°C during both growth and induction phases

    • Growth phase for induction: Mid-log phase (OD600 ~0.5)

    • Induction time: 2-3 hours post-induction

    • Media: Standard LB medium with appropriate antibiotics

    • Inducer concentration: 1 mM IPTG for T7-based systems or 50 ng/ml anhydrotetracycline for tet-inducible systems

    • Salt concentrations: Be aware that high salt concentrations can cause aggregation in some deletion strains, which requires specific handling procedures

  • What host strains are most effective for recombinant membrane protein expression?

    The following table summarizes key E. coli strains for membrane protein expression:

    StrainDescriptionAdvantagesBest Used For
    BL21(DE3)Standard expression strainWell-established, good general expressionInitial expression trials
    BL21 Gold(DE3)Enhanced expression strainReduced proteolysis, higher transformation efficiencyBaseline for comparison with deletion strains
    BL21ΔABCFQuadruple deletion (ΔOmpA, ΔOmpC, ΔOmpF, ΔLamB)Significantly improved expression, better protein quality, reduced backgroundChallenging membrane proteins, in situ studies
    BL21 Omp8Similar to ΔABCF but created with Tn5 transposonPreviously used for membrane protein expressionLess stable than the new deletion strains

Advanced Research Questions

  • How do BL21 deletion mutant strains improve recombinant membrane protein yields?

    BL21 deletion mutant strains improve membrane protein expression through multiple mechanisms:

    • Reduced competition for BAM complex: With fewer abundant endogenous OMPs requiring processing, more BAM complex capacity is available for recombinant proteins

    • Decreased envelope stress: Lower burden on membrane insertion pathways potentially reduces stress response activation and associated protease expression

    • Increased membrane availability: Deletion of abundant OMPs creates more "space" in the outer membrane for recombinant proteins

    • Improved membrane insertion: Test proteins show better insertion efficiency with less misfolded species in deletion strains

    • Simplified purification: The absence of major endogenous OMPs allows simpler purification strategies, potentially without requiring affinity tags

    Quantitative ELISA data shows significantly higher expression levels of test proteins in BL21ΔABCF compared to both the parent strain BL21(DE3) and the earlier Omp8 strain .

  • How can I perform in situ structural and functional studies of yhhN in a native membrane environment?

    Deletion mutant strains offer unique advantages for in situ studies:

    • Low background of endogenous OMPs allows direct measurement of the protein of interest in native membranes

    • For NMR studies, proteins can be expressed in isotope-labeled medium in the BL21ΔABCF strain, with subsequent spectra measured directly from membrane preparations without purification

    • This approach has been successfully employed for membrane proteins like YadA, where NMR spectra were obtained from the protein in native membranes

    • The clean background facilitates other biophysical techniques such as EPR, fluorescence spectroscopy, or mass spectrometry

    • For yhhN characterization, this approach could provide valuable structural and dynamic information while maintaining the protein in its native lipid environment

  • What are the quantitative improvements in membrane protein expression using optimized strains?

    Experimental data from test proteins demonstrates significant improvements in the BL21ΔABCF strain:

    ProteinImprovement in BL21ΔABCF vs BL21(DE3)Detection MethodNotes
    OmpX~4-5 fold increaseCoomassie-stained SDS-PAGEDramatically improved expression
    OmpX-HA~3 fold increaseWhole-cell ELISAProperly inserted and surface-exposed
    YadAMSignificant improvementCoomassie-stained SDS-PAGEMore specific expression with fewer contaminants
    Intimin~2 fold increase of correctly folded speciesWestern blot & Whole-cell ELISAReduced misfolded 120 kDa species

    The ELISA data also demonstrated good reproducibility between biological replicates, confirming that these improvements are consistent and reliable .

  • How can I troubleshoot aggregation issues when expressing membrane proteins in deletion strains?

    Deletion strains may exhibit aggregation under certain conditions, but this can be managed:

    • Salt sensitivity: Some deletion strains show aggregation in high salt concentrations, particularly the quadruple mutant BL21ΔABCF

    • This phenomenon is observable as flocculation when divalent cations (MgCl₂ or CaCl₂) are added to cultures

    • Recommended handling procedures:

      1. Avoid high salt concentrations during growth when possible

      2. If high salt is necessary, maintain cells at 30°C during growth

      3. Process cells promptly after harvesting

      4. Consider buffer optimization during membrane isolation steps

    • Despite this tendency to aggregate, protein expression and membrane insertion remain efficient in these strains

  • What are the genetic stability considerations for specialized expression strains?

    Genetic stability is critical for reproducible membrane protein expression:

    • Previous deletion strains (e.g., Prilipov's Omp8) used Tn5 transposon insertions, which showed instability and prone to sudden lysis under stress conditions

    • The new deletion strains described in the search results used complete gene deletions leaving only minimal scar sequences, preventing genetic reversion

    • This improved genetic stability makes the new deletion strains more reliable for routine expression work

    • For yhhN expression, these genetically stable strains would provide more consistent results across different experiments and reduce the risk of spontaneous mutations affecting expression

  • How can I distinguish between properly inserted and misfolded species of membrane proteins?

    Several analytical approaches can differentiate properly inserted from misfolded protein:

    • Western blot analysis: Properly inserted Intimin appears as a distinct 95 kDa band, while misfolded species show as a 120 kDa band

    • The BL21ΔABCF strain shows enrichment of the correctly inserted 95 kDa species with reduction of the misfolded 120 kDa band

    • Whole-cell ELISA: This technique specifically detects surface-exposed epitopes, confirming proper membrane insertion and orientation

    • For difficult-to-express proteins like yhhN, these analytical methods would be valuable in optimizing expression conditions and confirming successful membrane insertion

Methodological Questions

  • What expression vectors are recommended for membrane protein expression?

    Vector selection is crucial for successful membrane protein expression:

    • T7-based expression vectors (pET series) are compatible with BL21(DE3) and its derivatives, including the deletion strains

    • Tetracycline-inducible vectors (e.g., pASK-IBA series) offer more tunable expression and have been successfully used with test membrane proteins

    • For challenging membrane proteins like yhhN, vectors with moderately strong promoters may be preferable to prevent overwhelming the membrane insertion machinery

    • Expression constructs may incorporate:

      • Affinity tags for purification and detection (His, Strep, HA)

      • Signal sequences appropriate for the target membrane compartment

      • Fusion partners that might enhance folding or solubility

  • What is the recommended protocol for outer membrane isolation and analysis?

    A standardized protocol for outer membrane isolation:

    1. Grow cultures to mid-log phase (OD₆₀₀ ~0.5)

    2. Induce protein expression (1 mM IPTG or 50 ng/ml anhydrotetracycline)

    3. Continue growth at 30°C for 2 hours

    4. Harvest cells by centrifugation

    5. Resuspend cells in buffer and disrupt by sonication or cell press

    6. Remove unbroken cells by low-speed centrifugation

    7. Separate membranes by ultracentrifugation

    8. Extract inner membranes with sarkosyl or similar detergent

    9. Collect outer membranes by ultracentrifugation

    10. Analyze by SDS-PAGE and/or Western blotting

    This protocol has been successfully used for isolation of various test membrane proteins from the BL21ΔABCF strain .

  • How can I quantitatively assess membrane protein expression using whole-cell ELISA?

    Whole-cell ELISA provides quantitative comparison of surface-exposed protein:

    1. Grow and induce bacteria as described previously

    2. Adjust all cultures to equal optical density (OD₆₀₀ = 0.2)

    3. Apply 100 μl of bacterial suspension to microtiter plate wells

    4. Allow bacteria to adhere (1 hour at room temperature)

    5. Wash wells three times with PBS + 0.1% BSA

    6. Block with PBS + 2% BSA (1 hour)

    7. Add primary antibody against your protein or its tag

    8. Wash and add HRP-conjugated secondary antibody

    9. Develop with colorimetric substrate (e.g., ABTS)

    10. Measure absorbance and compare between strains/conditions

    This method confirmed significantly higher expression of both OmpX-HA and Intimin in BL21ΔABCF compared to BL21(DE3) .

  • What purification strategies are most effective for recombinant membrane proteins?

    Purification approaches for membrane proteins like yhhN:

    1. Membrane preparation:

      • Isolate outer membranes as described previously

      • The quality of this initial step is crucial for downstream purification

    2. Extraction options:

      • Detergent solubilization (select detergents based on protein characteristics)

      • Amphipol extraction for sensitive membrane proteins

      • Native nanodiscs for maintaining lipid environment

    3. Chromatography strategies:

      • When expressed in BL21ΔABCF, ion exchange chromatography can be particularly effective due to reduced background of endogenous OMPs

      • This may allow purification without affinity tags, which could compromise protein function

      • Size exclusion chromatography for final polishing steps

      • If tags are used, affinity chromatography provides selective purification

    4. Quality assessment:

      • SDS-PAGE with Coomassie staining to assess purity

      • Western blotting for specific detection

      • Activity assays if available

  • How should I design expression constructs for uncharacterized membrane proteins like yhhN?

    Construct design considerations for optimal expression:

    1. Sequence analysis:

      • Predict transmembrane domains and topology

      • Identify potential signal sequences

      • Analyze hydrophobicity patterns

    2. Expression construct elements:

      • Appropriate signal sequence for the target membrane

      • Consider both N- and C-terminal tag positions (choosing locations that don't interfere with membrane insertion)

      • For β-barrel proteins, ensure the C-terminal insertion signal is preserved

    3. Tag selection:

      • Small tags (His, Strep, FLAG, HA) that minimally impact folding

      • Position tags in predicted extramembrane regions

      • Include protease cleavage sites if tag removal is desired

    4. Optimization strategies:

      • If initial constructs perform poorly, consider:

        • Truncated versions removing flexible regions

        • Fusion to well-expressed membrane proteins

        • Codon optimization for E. coli expression

    The BL21ΔABCF strain has demonstrated success with various tagged constructs, including C-terminal StrepII tags and HA tags inserted in extracellular loops .

  • What are the best approaches for functional characterization of an uncharacterized membrane protein?

    Functional characterization strategies for yhhN:

    1. Bioinformatic analysis:

      • Sequence homology with characterized proteins

      • Structural predictions to identify potential functional domains

      • Genomic context analysis for functional clues

    2. Expression and purification:

      • Use BL21ΔABCF for optimal expression and membrane insertion

      • Purify in native-like conditions to preserve function

    3. Biophysical characterization:

      • NMR studies in native membranes exploiting the low background of deletion strains

      • Thermal stability assays to identify potential ligands

      • Structural studies by single-particle cryo-EM or crystallography

    4. Functional screening:

      • Ligand binding assays

      • Transport assays if a transporter function is suspected

      • Interaction studies with potential partner proteins

      • Phenotypic analysis of knockout/complementation strains

    5. In situ analysis:

      • Localization studies in native membranes

      • Crosslinking to identify interaction partners

      • Label-free mass spectrometry to identify co-purifying factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.