Recombinant Uncharacterized membrane protein yliF (yliF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dgcI; yliF; Z1058; ECs0913; Probable diguanylate cyclase DgcI; DGC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
dgcI
Target Protein Sequence
MSRINKFVLTVSLLIFIMISAVACGIYTQMVKERVYSLKQSVIDTAFAVANIAEYRRSVA IDLINTLNPTEEQLLVGLRTAYADSVSPSYLYDVGPYLISSDECIQVKEFEKNYCADIMQ VVKYRHVKNTGFISFDGKTFVYYLYPVTHNRSLIFLLGLERFSLLSKSLAMDSENLMFSL FKNGKPVTGDEYNAKNAIFTVSEAMEHFAYLPTGLYVFAYKKDVYLRVCTLIIFFAALVA VISGASCLYLVRRVINRGIVEKEAIINNHFERVLDGGLFFSAADVKKLYSMYNSAFLDDL TKAMGRKSFDEDLKALPEKGGYLCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPV DKGKVYRFGGDEFAVIYTGGTLEELLSILKEIVHFQVGSINLSTSIGVAHSNECTTVERL KMLADERLYKSKKNGRAQISWQ
Uniprot No.

Target Background

Function

This recombinant uncharacterized membrane protein, yliF, catalyzes the synthesis of cyclic-di-GMP (c-di-GMP) through the condensation of two GTP molecules.

Database Links

KEGG: ece:Z1058

STRING: 155864.Z1058

Subcellular Location
Cell membrane; Lipid-anchor.

Q&A

What is yliF and what organism does it come from?

yliF is an uncharacterized membrane protein found in Escherichia coli, including strains like E. coli O157:H7. It has also been annotated as dgcI in some databases and is classified as a putative lipoprotein or predicted diguanylate cyclase . The protein has been identified through genomic analysis, but its specific function remains to be fully characterized. In E. coli O157:H7, it is encoded by gene locus ECs0913 with alternate locus names of Z1058 .

What expression systems are optimal for recombinant yliF production?

Multiple expression systems have been employed for the production of recombinant yliF, each with distinct advantages:

Expression SystemAdvantagesLimitationsResearch Applications
E. coliHigh yield, cost-effective, rapid growthMay form inclusion bodiesInitial functional studies, antibody production
YeastBetter protein folding, some post-translational modificationsLower yield than E. coliAlternative when E. coli expression fails
BaculovirusExcellent for complex membrane proteinsComplex setup, high costStructural studies requiring native-like folding
Mammalian cellsNative-like environment for eukaryotic proteinsHighest cost, lowest yieldInteraction studies with mammalian proteins
Cell-free expressionAvoids toxicity issues, direct incorporation into lipid environmentsLimited scaleSingle-molecule studies, rapid screening

Commercial sources typically offer yliF with purity ≥85% as determined by SDS-PAGE , with protein expressed in various systems based on the intended application.

What purification strategies are most effective for membrane proteins like yliF?

Purification of membrane proteins like yliF requires specialized approaches:

  • Membrane solubilization: The choice of detergent is critical. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are often used for initial extraction while maintaining protein structure and function .

  • Affinity chromatography: Fusion tags facilitate purification – polyhistidine (His) tags are commonly used for metal affinity chromatography, while other options include streptavidin-binding peptide or FLAG tags for immunoaffinity approaches .

  • Size exclusion chromatography: This step separates properly folded protein from aggregates and removes detergent micelles, providing information about oligomeric state .

  • Sample quality assessment: Techniques like dynamic light scattering, thermal stability assays, and activity measurements help evaluate protein integrity throughout purification .

Recent advances in membrane protein purification include the use of styrene-maleic acid copolymers (SMALPs) that extract proteins with their native lipid environment, potentially preserving functional properties better than traditional detergent approaches.

How can yliF be stabilized for structural and functional studies?

Stabilizing membrane proteins like yliF for experimental studies requires consideration of multiple factors:

  • Buffer optimization:

    • pH: Typically between 7.0-8.0 for E. coli membrane proteins

    • Salt concentration: Usually 100-300 mM NaCl

    • Additives: Glycerol (10-25%) improves stability

  • Lipid supplementation:

    • Addition of E. coli lipid extracts can maintain native-like environment

    • Specific lipids may be required for function and stability

  • Alternative membrane mimetics:

    • Nanodiscs provide a bilayer environment with defined size

    • Bicelles combine aspects of micelles and bilayers

    • Amphipols can stabilize membrane proteins in detergent-free solutions

  • Storage conditions:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

  • Protein engineering:

    • Truncation of flexible regions

    • Introduction of stabilizing mutations

    • Fusion with stabilizing partners

What methods are most suitable for structural characterization of yliF?

Multiple complementary approaches can be employed for structural characterization of membrane proteins like yliF:

  • X-ray crystallography: While challenging due to the difficulty in forming well-diffracting crystals of membrane proteins, it can provide atomic-resolution structures. Lipidic cubic phase (LCP) crystallization has improved success rates for membrane proteins .

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structure determination without crystallization. Recent advances allow near-atomic resolution structures, particularly valuable for larger protein complexes .

  • Nuclear Magnetic Resonance (NMR): Provides dynamic information and works well for smaller membrane proteins or domains. Requires isotopic labeling (15N, 13C, 2H) and specialized detergent systems .

  • Single-molecule approaches: Techniques like magnetic tweezers can provide insights into structural transitions and folding dynamics, as demonstrated in recent studies on model membrane proteins .

  • Computational prediction: Recent advances in AI-based structure prediction have revolutionized our ability to model membrane proteins with limited experimental data .

For yliF, a multi-technique approach would likely be most informative, combining computational prediction with experimental validation.

What computational methods can predict the structure and function of yliF?

Computational approaches have become increasingly powerful for predicting membrane protein structures:

  • Deep learning methods: Recent advances in AI-based protein structure prediction have dramatically improved our ability to model membrane proteins. These approaches could generate detailed structural models of yliF even without close structural homologs .

  • Evolutionary coupling analysis: This approach identifies co-evolving residue pairs that are likely in contact, providing distance constraints for modeling. It has been successfully applied to predict structures of various membrane proteins .

  • Molecular dynamics simulations: MD simulations can refine predicted structures in membrane environments, identify stable conformations, and simulate protein-lipid interactions. These approaches reveal how transmembrane domains interact with the lipid bilayer .

  • Ab initio modeling: For proteins like yliF with few structural homologs, ab initio Rosetta atomistic modeling with membrane-specific energy functions can predict structure from sequence alone .

  • Functional annotation: Computational approaches can predict functional sites, binding pockets, and potential interaction partners based on sequence conservation patterns and structural features.

What are the challenges in crystallizing membrane proteins like yliF?

Membrane protein crystallization faces several unique challenges:

  • Detergent selection: Finding a detergent that maintains protein stability while allowing crystal formation is often empirical and labor-intensive .

  • Limited crystal contacts: The detergent micelle surrounding the hydrophobic regions limits the surface available for crystal lattice formation .

  • Conformational heterogeneity: Membrane proteins typically adopt multiple conformational states, hindering crystal formation and quality .

  • Technical considerations:

    • Higher protein quantities needed for extensive crystallization trials

    • Specialized crystallization methods (LCP, bicelles) require expertise

    • Crystals often diffract poorly, requiring extensive optimization

  • Successful strategies:

    • Fusion with crystallization chaperones like T4 lysozyme

    • Antibody fragment co-crystallization to increase hydrophilic surface

    • Thermostabilizing mutations to reduce conformational heterogeneity

    • Lipidic cubic phase crystallization to maintain a lipid-like environment

What is the predicted function of yliF and how can it be experimentally verified?

Based on sequence analysis, yliF (annotated as dgcI in some databases) is predicted to be a diguanylate cyclase involved in cyclic di-GMP signaling . This bacterial second messenger regulates processes including biofilm formation, virulence, and motility.

Experimental verification approaches include:

  • Enzymatic activity assays:

    • Measure conversion of GTP to cyclic di-GMP

    • Compare activity of wild-type and mutant versions

    • Determine kinetic parameters (Km, Vmax, etc.)

  • Genetic approaches:

    • Generate clean deletion mutants (ΔyliF)

    • Assess phenotypes related to c-di-GMP signaling (biofilm formation, motility)

    • Complement with wild-type and mutant versions

  • Structural studies:

    • Identify conserved catalytic residues

    • Compare with known diguanylate cyclase structures

    • Use mutagenesis to confirm functional predictions

  • Cellular localization:

    • Determine membrane localization pattern

    • Identify potential interaction partners

    • Correlate localization with function

How do transmembrane domains influence the function of proteins like yliF?

Transmembrane domains play crucial roles in membrane protein function through several mechanisms:

Recent research using programmed membrane proteins (proMPs) with defined oligomeric states has demonstrated that transmembrane domain oligomerization directly influences signaling output in engineered receptors, with activity scaling linearly with oligomeric state .

How can de novo protein design approaches inform our understanding of yliF?

De novo protein design offers powerful approaches to understand membrane proteins like yliF:

  • Minimal functional models: Designing simplified versions that maintain key structural features can help identify essential elements for function. Recent work has created de novo transmembrane proteins with defined oligomeric states that maintained predicted structures in membrane environments .

  • Structure-function relationships: By systematically varying transmembrane domain features in designed proteins, researchers can establish principles governing membrane protein folding and function. This approach revealed how transmembrane domain interactions influence receptor signaling in chimeric antigen receptors .

  • Soluble analogs: Recent advances have enabled the design of soluble analogs of membrane proteins, creating water-soluble versions that recapitulate key structural features without the challenges of membrane environments .

  • Programmable oligomerization: Designed transmembrane domains with defined oligomeric states (monomers to tetramers) allow systematic investigation of how oligomerization influences function, revealing that signaling activity scales linearly with oligomeric state in model systems .

  • Binding partner design: Computational design of specific binding partners can help capture and study transient interactions, potentially revealing yliF's interaction network.

These approaches could be applied to create simplified models of yliF, helping to isolate and study specific functional domains or interaction interfaces.

What role might yliF play in bacterial membrane processes and signaling?

Several lines of evidence suggest potential roles for yliF in bacterial membrane processes:

  • Cyclic di-GMP signaling: As a putative diguanylate cyclase (annotated as dgcI in some databases), yliF likely participates in cyclic di-GMP signaling pathways that regulate biofilm formation, motility, and virulence .

  • Membrane organization: The transmembrane topology suggests yliF could influence membrane properties or organization, potentially through interactions with other membrane proteins or lipids.

  • Environmental sensing: The membrane-spanning regions could detect environmental cues, with the cytoplasmic domains transducing these signals to intracellular responses.

  • Protein-protein interactions: yliF may form functional complexes with other membrane proteins, similar to how Erd1 interacts with Golgi enzymes and the cytosolic receptor Vps74 to facilitate protein recycling .

  • Pathogenicity factors: In pathogenic strains like E. coli O157:H7, yliF might contribute to virulence through regulation of adhesion, invasion, or host-pathogen interactions.

Future research directions should include comprehensive interactome mapping, phenotypic characterization of deletion strains under various conditions, and structural studies to identify potential binding sites or catalytic domains.

How can single-molecule techniques advance our understanding of membrane proteins like yliF?

Single-molecule techniques offer unique insights into membrane protein structure, dynamics, and function:

  • Force spectroscopy: Magnetic tweezers can reveal structural transitions under applied force, providing insights into folding pathways and stability. Recent advances have developed robust linkage systems that remain stable for ~12 hours at forces up to 50 pN, enabling extended observation of membrane protein dynamics .

  • Conformational dynamics: Single-molecule FRET can detect conformational changes in real-time, revealing functionally relevant states that might be obscured in ensemble measurements.

  • Oligomerization analysis: Techniques like single-molecule photobleaching can determine precise oligomeric states in native-like membrane environments.

  • Folding kinetics: Recent single-molecule studies revealed that membrane proteins fold much more slowly than soluble proteins, with a "speed limit" of approximately 21 ms for helical hairpin formation in lipid bilayers (compared to microseconds for soluble proteins) .

  • Membrane insertion dynamics: Single-molecule approaches can track the insertion and assembly of transmembrane domains, providing insights into biogenesis pathways.

A recent study using dibenzocyclooctyne cycloaddition and traptavidin binding created stable molecular tethers for membrane proteins, enabling observation of helix-coil transitions for over 9 hours at constant force . Similar approaches could reveal the folding dynamics and stability of yliF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.